Os04t0594800-01

Locus

Os04g0594800

Description

Similar to OSIGBa0142I02-OSIGBa0101B20.31 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOPT6

Oryzabase Gene Name Synonym(s)

Oligopeptide transporter 6

Transcript Evidence

AK070801 (DDBJ, Best hit)

Protein Evidence

Q01HF8 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Tetrapeptide transporter, OPT1/isp4 (IPR004648)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

J023072A11 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0594800-01)

Others

Oryzabase (12494)

Transcript

2594 bp

>Os04t0594800-01 Similar to OSIGBa0142I02-OSIGBa0101B20.31 protein.
TGCCAGCAATTCCGTCACTTTGACAGATTATTCTGAAGCGCGAGGTTTTGCAGGCGCCTC
CTCGCGCGGGGTAGCAATGGAGATTGAGCATCTCGGCGCCCGCGCGGCCGCCGCCGCCGG
CGAGGATGACCAGTCGCCGGTGGAGCAGGTCCGGCTGACCGTGCCGACGACCGACGACCC
GTCTCTGCCGGTATGGACGTTCCGGATGTGGACCATCGGGCTCCTCTCCTGCGCCATGCT
CTCCTACATCAACCAGTTCTTCTCCTACCGCTCTGAGCCCATCGTCATCACCCAGATCAC
TGTCCAGGTGGCGGCGCTGCCAATAGGGCACTTCTTGGCACGCGTGCTGCCGAAGAGGAA
GTTCACGGTGTTCGGGCGGGAGTGCTCGCTGAACCCTGGGCCATTCAACGTGAAGGAGCA
CGTCCTGATATCCATCTTCGCCAACGCCGGCGCCGCGTTCGGCAACGGCGGCGCCTACGC
CATCGACATCATCAACATCATCAAGGCGTTCTACCACCGCAGCATCTCCTTTCCCACCAG
CCTCCTCCTCGTCATCACCACCCAGGTGTTGGGCTACGGATGGGCAGGGCTGATGAGGAA
GTACGTGGTGGAGCCGGCGCACATGTGGTGGCCGCAGAGTCTCGTGCAGGTTTCCCTCCT
GAGGGCGTTGCACGAGAAGGAGAACCTGCGGATGACGCGGGCCAAGTTCTTCCTGATCGC
GCTGATCTGCAGCGCGGCGTGGTACGTGGTGCCGGGCTACCTGTTCCCGACCGTGGGCGC
GGTGTCGTGGCTGTGCTGGGCGTTCCCGAGGTCGGTGACGATGCAGCAGATCGGGTCCGG
CATGAGCGGCCTCGGCGTCGGCGCCTTCACGCTCGACTGGGCCACCGTCGTCTCCTTCCT
GGGCAGCCCGCTCGTGTACCCGTTCTTCGCCATCGTCAACGTCTGGGTCGGCTTCGTGCT
CCTCGTCTACGTCATGCTGCCCATCGCCTACTGGGTGCTCAACCTGTACCAGGCCAGCAC
GTTCCCCTTTTTCTCCGCGAGCCTGTTCGACCACACCGGCGAGGAGTACAGGATCTCGGA
GATCGTCAACGACAGGTTCGAGCTCGACACGGACGCCTACGCGCGGCAGGGGAAGATCCA
CCTCAGCCTCTTCTTCGCCACCTCCTACGGCCTCGGCTTCGCCACCATCGCCGCCACCCT
GTCCCACGTCACGCTCTTCTATGGAACGGAGATGTATCGCAGGTTCCGGCAGGCGGCCAG
GGAGAACCCGGACGTGCACACGAGGCTGATGAGGAGGTACGATGACATCCCCAACTGGTG
GTTCTACGGCATGCTCGCGTTGGCCATGGTGGCGGCGCTGTTGCTCTGCACCGTGTTCAA
GGACGAGGTGCAGCTGCCGTGGTGGGCGCTACTCTGCGCCGTGGCCGTGGCCGCCTTCTT
CACGCTCCCCATCAGTGTTATCACCGCCACCACAAACACGACCCCAGGGTTGAACATCAT
CACGGAGTATGTGATGGGGCTGATCATGCCGGGGAAGCCGATAGCCAACGTGTGCTTCAA
GGTGTATGGTTACATCAGCATGAACCAGGCCGTCTCCTTCCTCACTGACTTCAAACTCGG
CCACTACATGAAGATTCCTCCAAGATCCATGTTTCTAGTCCAGTTCATCGGGACGATCGT
GGCGGGGACGGTGAACATGTCGGTGGCGTGGTGGCTGCTGTCGACGGTGCCGCACATCTG
CGACAAGAAGCACCTCCCGGAGGGGAGCCCGTGGACGTGCCCGGGCTCCCGCGTGTTCTT
CGACGCGTCGGTGATCTGGGGACTGGTCGGGCCTCGCCGGATCTTCGGCCCGCTCGGCTA
CTACGGCGCGCTCAACTGGTTCTTCCTCGGCgggctggcagggccggcggtggtgtggct
gctggcgagggcgctgccgcggcacgccggctggATCAGGCTCATCCACCTCCCCGTGCT
CCTCGGCGCCACCGCCAACATGCCGCCGGCGTCGACGCTCAACTACACGGCGTGGTGCTC
CGTCGGCGCCGTGTTCAACTACCTGGTGTTCCGCCGCCGCAAGGCGTGGTGGCAGCGGTA
CAACTACGTGCTGTCGGCGGCGATGGACGCCGGCGTGGCCATCATGGGCGTGCTCATCTA
CTTCTGCCTGTCCAGCCGCGGCATCACCCCAGACTGGTGGGGCAACAGCGACATCAACAT
CGACCACTGCGACCTCTCCACCTGCCCCACCGCCAAGGGCGTCATTGTGGAGGGATGTCC
CGTCTTCTGATCGATCATCCATCCAATATACATATTTCCCCCGTAGATGTGTTCTTCGTG
CGAAACTAGATCAGTAAAATCAATCAGAATCTGAATCTCTACTCGTTTAATATGGCAGGA
CTGATGCTGTTCTTATTTAAAGTTGTATATATCATTTGGGTTTTTAGGTTTCCAAATGCT
CTTCTTTTTCGTGTTTTAACCAAGTTCAGTGAGCTCAGTTACCCAGTTAGTATATTATAG
AATTGGTTTCGCTCCAATGGAGTTTTATTGCTGTGTTTTAATTGAGTTCAATGAGATATA
TATTGGTTAAGTCC

CDS

2214 bp

>Os04t0594800-01 Similar to OSIGBa0142I02-OSIGBa0101B20.31 protein.
ATGGAGATTGAGCATCTCGGCGCCCGCGCGGCCGCCGCCGCCGGCGAGGATGACCAGTCG
CCGGTGGAGCAGGTCCGGCTGACCGTGCCGACGACCGACGACCCGTCTCTGCCGGTATGG
ACGTTCCGGATGTGGACCATCGGGCTCCTCTCCTGCGCCATGCTCTCCTACATCAACCAG
TTCTTCTCCTACCGCTCTGAGCCCATCGTCATCACCCAGATCACTGTCCAGGTGGCGGCG
CTGCCAATAGGGCACTTCTTGGCACGCGTGCTGCCGAAGAGGAAGTTCACGGTGTTCGGG
CGGGAGTGCTCGCTGAACCCTGGGCCATTCAACGTGAAGGAGCACGTCCTGATATCCATC
TTCGCCAACGCCGGCGCCGCGTTCGGCAACGGCGGCGCCTACGCCATCGACATCATCAAC
ATCATCAAGGCGTTCTACCACCGCAGCATCTCCTTTCCCACCAGCCTCCTCCTCGTCATC
ACCACCCAGGTGTTGGGCTACGGATGGGCAGGGCTGATGAGGAAGTACGTGGTGGAGCCG
GCGCACATGTGGTGGCCGCAGAGTCTCGTGCAGGTTTCCCTCCTGAGGGCGTTGCACGAG
AAGGAGAACCTGCGGATGACGCGGGCCAAGTTCTTCCTGATCGCGCTGATCTGCAGCGCG
GCGTGGTACGTGGTGCCGGGCTACCTGTTCCCGACCGTGGGCGCGGTGTCGTGGCTGTGC
TGGGCGTTCCCGAGGTCGGTGACGATGCAGCAGATCGGGTCCGGCATGAGCGGCCTCGGC
GTCGGCGCCTTCACGCTCGACTGGGCCACCGTCGTCTCCTTCCTGGGCAGCCCGCTCGTG
TACCCGTTCTTCGCCATCGTCAACGTCTGGGTCGGCTTCGTGCTCCTCGTCTACGTCATG
CTGCCCATCGCCTACTGGGTGCTCAACCTGTACCAGGCCAGCACGTTCCCCTTTTTCTCC
GCGAGCCTGTTCGACCACACCGGCGAGGAGTACAGGATCTCGGAGATCGTCAACGACAGG
TTCGAGCTCGACACGGACGCCTACGCGCGGCAGGGGAAGATCCACCTCAGCCTCTTCTTC
GCCACCTCCTACGGCCTCGGCTTCGCCACCATCGCCGCCACCCTGTCCCACGTCACGCTC
TTCTATGGAACGGAGATGTATCGCAGGTTCCGGCAGGCGGCCAGGGAGAACCCGGACGTG
CACACGAGGCTGATGAGGAGGTACGATGACATCCCCAACTGGTGGTTCTACGGCATGCTC
GCGTTGGCCATGGTGGCGGCGCTGTTGCTCTGCACCGTGTTCAAGGACGAGGTGCAGCTG
CCGTGGTGGGCGCTACTCTGCGCCGTGGCCGTGGCCGCCTTCTTCACGCTCCCCATCAGT
GTTATCACCGCCACCACAAACACGACCCCAGGGTTGAACATCATCACGGAGTATGTGATG
GGGCTGATCATGCCGGGGAAGCCGATAGCCAACGTGTGCTTCAAGGTGTATGGTTACATC
AGCATGAACCAGGCCGTCTCCTTCCTCACTGACTTCAAACTCGGCCACTACATGAAGATT
CCTCCAAGATCCATGTTTCTAGTCCAGTTCATCGGGACGATCGTGGCGGGGACGGTGAAC
ATGTCGGTGGCGTGGTGGCTGCTGTCGACGGTGCCGCACATCTGCGACAAGAAGCACCTC
CCGGAGGGGAGCCCGTGGACGTGCCCGGGCTCCCGCGTGTTCTTCGACGCGTCGGTGATC
TGGGGACTGGTCGGGCCTCGCCGGATCTTCGGCCCGCTCGGCTACTACGGCGCGCTCAAC
TGGTTCTTCCTCGGCgggctggcagggccggcggtggtgtggctgctggcgagggcgctg
ccgcggcacgccggctggATCAGGCTCATCCACCTCCCCGTGCTCCTCGGCGCCACCGCC
AACATGCCGCCGGCGTCGACGCTCAACTACACGGCGTGGTGCTCCGTCGGCGCCGTGTTC
AACTACCTGGTGTTCCGCCGCCGCAAGGCGTGGTGGCAGCGGTACAACTACGTGCTGTCG
GCGGCGATGGACGCCGGCGTGGCCATCATGGGCGTGCTCATCTACTTCTGCCTGTCCAGC
CGCGGCATCACCCCAGACTGGTGGGGCAACAGCGACATCAACATCGACCACTGCGACCTC
TCCACCTGCCCCACCGCCAAGGGCGTCATTGTGGAGGGATGTCCCGTCTTCTGA

Protein

738 aa

>Os04t0594800-01 Similar to OSIGBa0142I02-OSIGBa0101B20.31 protein.
MEIEHLGARAAAAAGEDDQSPVEQVRLTVPTTDDPSLPVWTFRMWTIGLLSCAMLSYINQ
FFSYRSEPIVITQITVQVAALPIGHFLARVLPKRKFTVFGRECSLNPGPFNVKEHVLISI
FANAGAAFGNGGAYAIDIINIIKAFYHRSISFPTSLLLVITTQVLGYGWAGLMRKYVVEP
AHMWWPQSLVQVSLLRALHEKENLRMTRAKFFLIALICSAAWYVVPGYLFPTVGAVSWLC
WAFPRSVTMQQIGSGMSGLGVGAFTLDWATVVSFLGSPLVYPFFAIVNVWVGFVLLVYVM
LPIAYWVLNLYQASTFPFFSASLFDHTGEEYRISEIVNDRFELDTDAYARQGKIHLSLFF
ATSYGLGFATIAATLSHVTLFYGTEMYRRFRQAARENPDVHTRLMRRYDDIPNWWFYGML
ALAMVAALLLCTVFKDEVQLPWWALLCAVAVAAFFTLPISVITATTNTTPGLNIITEYVM
GLIMPGKPIANVCFKVYGYISMNQAVSFLTDFKLGHYMKIPPRSMFLVQFIGTIVAGTVN
MSVAWWLLSTVPHICDKKHLPEGSPWTCPGSRVFFDASVIWGLVGPRRIFGPLGYYGALN
WFFLGGLAGPAVVWLLARALPRHAGWIRLIHLPVLLGATANMPPASTLNYTAWCSVGAVF
NYLVFRRRKAWWQRYNYVLSAAMDAGVAIMGVLIYFCLSSRGITPDWWGNSDINIDHCDL
STCPTAKGVIVEGCPVF*

5'UTR

chr04:30062428..30062503 (+ strand) : 76 bp

CDS

chr04:30062504..30062734 (+ strand) : 231 bp

chr04:30062830..30063087 (+ strand) : 258 bp

chr04:30063182..30063279 (+ strand) : 98 bp

chr04:30063374..30063937 (+ strand) : 564 bp

chr04:30064032..30064284 (+ strand) : 253 bp

chr04:30064376..30064558 (+ strand) : 183 bp

chr04:30064639..30065265 (+ strand) : 627 bp

3'UTR

chr04:30065266..30065569 (+ strand) : 304 bp

FASTA

>Os04t0594800-01 class=Sequence position=chr04:30062428..30065569 (+ strand)
TGCCAGCAAT TCCGTCACTT TGACAGATTA TTCTGAAGCG CGAGGTTTTG CAGGCGCCTC CTCGCGCGGG GTAGCAATGG
AGATTGAGCA TCTCGGCGCC CGCGCGGCCG CCGCCGCCGG CGAGGATGAC CAGTCGCCGG TGGAGCAGGT CCGGCTGACC
GTGCCGACGA CCGACGACCC GTCTCTGCCG GTATGGACGT TCCGGATGTG GACCATCGGG CTCCTCTCCT GCGCCATGCT
CTCCTACATC AACCAGTTCT TCTCCTACCG CTCTGAGCCC ATCGTCATCA CCCAGATCAC TGTCCAGGTC AGTTTGTCGA
TGCAGAATTC ACGCACAAAA CCACGAGGAG TCCATGGATG TAATGTTGTT TATATATATG TGCAATGGAT GGATGGATGC
AGGTGGCGGC GCTGCCAATA GGGCACTTCT TGGCACGCGT GCTGCCGAAG AGGAAGTTCA CGGTGTTCGG GCGGGAGTGC
TCGCTGAACC CTGGGCCATT CAACGTGAAG GAGCACGTCC TGATATCCAT CTTCGCCAAC GCCGGCGCCG CGTTCGGCAA
CGGCGGCGCC TACGCCATCG ACATCATCAA CATCATCAAG GCGTTCTACC ACCGCAGCAT CTCCTTTCCC ACCAGCCTCC
TCCTCGTCAT CACCACCCAG GTTACGTACT ACACACATTC ATGCAACGAT CCATTCTTGC GTAGCTGCAA CTAATATGAT
GTTTCGATCA CTGGACGCAC GTACGCATAC ACAGGTGTTG GGCTACGGAT GGGCAGGGCT GATGAGGAAG TACGTGGTGG
AGCCGGCGCA CATGTGGTGG CCGCAGAGTC TCGTGCAGGT TTCCCTCCTG AGGTGAGCAC CCGATCACCC TGATCGATCG
GTCGATGGAT TCACGGAAAA TTCACAGGGA ATTCACGTAC GCGCGCGTGC GTGTGCGTGC ATGCAGGGCG TTGCACGAGA
AGGAGAACCT GCGGATGACG CGGGCCAAGT TCTTCCTGAT CGCGCTGATC TGCAGCGCGG CGTGGTACGT GGTGCCGGGC
TACCTGTTCC CGACCGTGGG CGCGGTGTCG TGGCTGTGCT GGGCGTTCCC GAGGTCGGTG ACGATGCAGC AGATCGGGTC
CGGCATGAGC GGCCTCGGCG TCGGCGCCTT CACGCTCGAC TGGGCCACCG TCGTCTCCTT CCTGGGCAGC CCGCTCGTGT
ACCCGTTCTT CGCCATCGTC AACGTCTGGG TCGGCTTCGT GCTCCTCGTC TACGTCATGC TGCCCATCGC CTACTGGGTG
CTCAACCTGT ACCAGGCCAG CACGTTCCCC TTTTTCTCCG CGAGCCTGTT CGACCACACC GGCGAGGAGT ACAGGATCTC
GGAGATCGTC AACGACAGGT TCGAGCTCGA CACGGACGCC TACGCGCGGC AGGGGAAGAT CCACCTCAGC CTCTTCTTCG
CCACCTCCTA CGGCCTCGGC TTCGCCACCA TCGCCGCCAC CCTGTCCCAC GTCACGCTCT TCTATGGAAC GTACGTGTCT
TAATTAATTT GTGTGTTTTG TTTTGATGGT TTTGATCGAT CGATCGATTT GATGTTGTGT GCGTGCGTTC GTGGATGGAT
GCAGGGAGAT GTATCGCAGG TTCCGGCAGG CGGCCAGGGA GAACCCGGAC GTGCACACGA GGCTGATGAG GAGGTACGAT
GACATCCCCA ACTGGTGGTT CTACGGCATG CTCGCGTTGG CCATGGTGGC GGCGCTGTTG CTCTGCACCG TGTTCAAGGA
CGAGGTGCAG CTGCCGTGGT GGGCGCTACT CTGCGCCGTG GCCGTGGCCG CCTTCTTCAC GCTCCCCATC AGTGTTATCA
CCGCCACCAC AAACACGGTG CGTACTAGTA TCTTGTTTCT TACCTCTTAG CTGCAAACTT GGAAGTTTGG AGGTACTGGA
GTCTTGTAAT TATGACGTTC ACCTGCAGAC CCCAGGGTTG AACATCATCA CGGAGTATGT GATGGGGCTG ATCATGCCGG
GGAAGCCGAT AGCCAACGTG TGCTTCAAGG TGTATGGTTA CATCAGCATG AACCAGGCCG TCTCCTTCCT CACTGACTTC
AAACTCGGCC ACTACATGAA GATTCCTCCA AGATCCATGT TTCTAGTCCA GGTACTACTA CCGGCACATA TATTCATATC
GTTAAAATCC CAACTTAATC CATTATATAA CCAAGAAAAT ATACGTATCA GTTCATCGGG ACGATCGTGG CGGGGACGGT
GAACATGTCG GTGGCGTGGT GGCTGCTGTC GACGGTGCCG CACATCTGCG ACAAGAAGCA CCTCCCGGAG GGGAGCCCGT
GGACGTGCCC GGGCTCCCGC GTGTTCTTCG ACGCGTCGGT GATCTGGGGA CTGGTCGGGC CTCGCCGGAT CTTCGGCCCG
CTCGGCTACT ACGGCGCGCT CAACTGGTTC TTCCTCGGCg ggctggcagg gccggcggtg gtgtggctgc tggcgagggc
gctgccgcgg cacgccggct ggATCAGGCT CATCCACCTC CCCGTGCTCC TCGGCGCCAC CGCCAACATG CCGCCGGCGT
CGACGCTCAA CTACACGGCG TGGTGCTCCG TCGGCGCCGT GTTCAACTAC CTGGTGTTCC GCCGCCGCAA GGCGTGGTGG
CAGCGGTACA ACTACGTGCT GTCGGCGGCG ATGGACGCCG GCGTGGCCAT CATGGGCGTG CTCATCTACT TCTGCCTGTC
CAGCCGCGGC ATCACCCCAG ACTGGTGGGG CAACAGCGAC ATCAACATCG ACCACTGCGA CCTCTCCACC TGCCCCACCG
CCAAGGGCGT CATTGTGGAG GGATGTCCCG TCTTCTGATC GATCATCCAT CCAATATACA TATTTCCCCC GTAGATGTGT
TCTTCGTGCG AAACTAGATC AGTAAAATCA ATCAGAATCT GAATCTCTAC TCGTTTAATA TGGCAGGACT GATGCTGTTC
TTATTTAAAG TTGTATATAT CATTTGGGTT TTTAGGTTTC CAAATGCTCT TCTTTTTCGT GTTTTAACCA AGTTCAGTGA
GCTCAGTTAC CCAGTTAGTA TATTATAGAA TTGGTTTCGC TCCAATGGAG TTTTATTGCT GTGTTTTAAT TGAGTTCAAT
GAGATATATA TTGGTTAAGT CC

Locus: Os04g0594800

Loading...

Locus: Os04g0594800

Loading...