Os04t0597600-01

Locus

Os04g0597600

Description

TGF-beta receptor, type I/II extracellular region family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PTR5

CGSNL Gene Name

PROTEIN TRANSPORTER 5

Oryzabase Gene Symbol Synonym(s)

OsPTR5, OsNPF7.4, NPF7.4

Oryzabase Gene Name Synonym(s)

NITRATE TRANSPORTER 1/PEPTIDE TRANSPORTER 7.4

Transcript Evidence

AK070216 (DDBJ, Best hit)

Protein Evidence

Q7XNU7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oligopeptide transport (GO:0006857)

Cellular Component: membrane (GO:0016020)

Molecular Function: transporter activity (GO:0005215)

Functional domain (InterPro)

Oligopeptide transporter (IPR000109)

Major facilitator superfamily domain, general substrate transporter (IPR016196)

Full-length cDNA

J023045E19 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0597600-01)

RiceXPro (AK070216)

Others

Oryzabase (8913)

KEGG (Os04t0597600-01)

Transcript

2943 bp

>Os04t0597600-01 TGF-beta receptor, type I/II extracellular region family protein.
ATCTCTCGTGCTCAGCTCGCAGCCAAAAACCCCAAGGCGCTCTCACGACGGCAGGAGCTA
GCTTAGCTGCAGAAAAAGCAGGTGACGTTGAATTCTGATTTCTGAACGAGTTGCAGCAGC
ATAGCGACAATGGACGCCGGCGACGCCATGGAGAGAGGCCAGCAGCGGCTGCCAGAGGTA
AGCATATGCACAACTTCACAACTATCTCGTTCTCCTCCTCTCACCGGTTTCGCTCATCAT
GAATTGATCTTTCTTAGTACTCCAGTTTGCAACTTGGAAACAAGCGATGGCAGTGAGAAT
GCACGCATATGGATCATAACTATAGCATAGTAATTTTCAGGCATGCTGTTATTGGTTTCA
CCTTCTTTAAATTCAGAGTTCAGATTGAAGAATGGGTTGTTATCAGGTTCACCAAAATGA
CAGAACAGAGGTGAATAGGTGAACGAAGGAAACAGTCATGGTCTACATCTATGTGGTGCA
GTTGCACCACTATTTGACCCTTTTCTACGCAAGATAGAGAATAATGTTACGGCTAAGACG
AACCGTATCCAAACACACTATAGTCGTACGACGTATTGGCACGTTGCCACGAGGGTGAGT
TGGTGGCAACACACTCATTGGTCAGGTCTCCATGGTTAAAACGAGCGTGAAAAATTCTGA
AGTCAGAAAAAATTAATAGTGTGTGTTTAATACTAAGAAATTTTGTCAGACTTTTCACGC
ATAAGTTTAAAAAAAAGTTGGTCAGAAAACTAAAGCAACAGAACACATACACACAAGTGC
ACCACAACCACCGTATACCTTTCGTATTCATCTGTACAAAGCTGCTTCCTTTATCCCTTT
ACGATTTTCAAGTACAATCGCTGACGTCTACAACAACGCCGCAAAAACTTTGATGGCTTG
TTCAGATATACAAGAAATAAAAAAAAATGTAAACTGACATGTTCTCCCCAAACTTTGAAC
TTGATCTGCAGAGCTGGAACCCGAAACTCCAGGACGACGTCAGCCTGACGGTGCCACTCA
TCCAGGACAAGAAGAGCGGGAGCAAAGCGCCGGCGGTGGTGCTAGGATTCGAGTGCTTGG
AGAGCACAGCGTTCAACGGCATTGCCACGAACCTGGTGGTGTACCTGGAGACCGTCCTGC
ACGGCAGCAGCCTCGCGAGCGCGTCCAATGTCACGACGTGGTTCGGCACGAGCTACCTCA
CGCCGGTGTTCGGCGCCATCATCGCCGACACGTTCTTCGGCAACTACAACACCATCCTCG
TCTCCCTCGTGTTCTACCTCCTGGGCATGGTGCTGGTCACCTTCTCGGCGTTCCTGCCGA
CCACCGCGCTGTGCGCCGTGGCGGGCTCGACGTCGTGCCAGCAGCCTGTGTTTGGCGCGC
AGACCATCGCCTTCGTGGGGCTCTACCTCGTGGCGTTCGGCAGCGGCGGCGTGCGCGCGG
CGCTGCTGCCGTTCGGCGCGGAGCAGTTCGACGACGACAACGCGGTGGACCGGGAGCGGA
AGATGTCCTTCTTCAGCTGGTTCTACATGTGCGTCGACTTCGGGATGATCGTGTCGGGCC
TATTCATCGTGTGGATCCAGCAGAACGTGAGCTGGGGACTCGGCTTCGGCATCGCCACGG
TTTGCGTCGCGATCGCGTTCGGCGGCTTCGTGCTCGCCACGCCCATGTACAAGCGCAGCA
TGCCCACCGGCACGCCGCTCAAGAGCCTCGCCCAGGTGGTGGTCGCCGCGTGCCGGAAGG
TCAGCCTCCGTGTCCCCGCCGACGCCGCCCTCCTCTACGAGGTCCATGACAAGATCGATC
AGCCCAAGATCACGCACACCGACGAGTTCAGCTTTCTTGACAAGGCGGCGGTGATCGTGC
AGTCCGACCTGGAAGAGGACTCGAACGACGCCTCGGCGGCGGCCGCGGGCTCGTGGAGGC
TATGCACGGTGACGCAGGTGGAGGAGCTCAAGATCCTGATGCGGCTGCTGCCGATATGGG
CGACGAGCATCGTGCTGTCGGCGGCGTACGCGCAGCTGAACACCACGTTCGTGCAGCAGG
GCGCCGCGATGAACATGCGGATCATGTCGTTCACCATCCCCGCCGCGTCGATGGTGTCCT
TCGAGGTGTTCTGCGTCCTGGCATGGGTGCTCGTCTACGGCTCGGTGATCGTGCCGCTCC
TCAGGAGCTTCTCCCCGGCCAACGGCGAGCCGTCGCAGCTGCGGCGCATGGGCGCCGGCC
GTCTGCTCATCGCGGTCGCCATGGCCATCGCCGCGCTGGTGGAGATGGTGCGCCTCGACG
CGGCGGCGCGCGGCGAGTCCCTGAGCATCGCGTGGCAGATGCCGCAGTACTTCATGCTGG
CCGGCGGTGAGGTGTTCTGCTACATCGCGCAGCTGGAGTTCTTCTACAGCGAGGCGCCGG
AGTCCATGAAGAGCATCTGCACGTCGCTGGCGCTGCTCACCGTGGCGCTGGGAAGCTACA
TGAGCTCCTTCATCTACGCCGTCGTGAACGCGTTCACCGCCGTGGACGGCCGGCCCGGGT
GGATTTCGGACAACCTCAACGAGGGACACCTGGACTACTTCTTCTGGGTCATGTCGGCGC
TGTGCACGCTCAACTTCGTCGTGTACAGCGCGTTCGCGCGGAACTACAAGGTGAAGACGG
TCGTGTCATGATCGCTCGCCCACACGTCCGCGCGTACATAGGCAAAACAAGGTAGCGTTA
GGAACGGGGTGCGTCCAGGAAATACACGGGACACGTCCGGTGCACCTGCGAAACGGTTTT
TGTATCGCAGCGACCAATATCTTCTGGCTGCTGCTGATCGACGCCATCGTGTTCCTTGTT
GTTTATTGTTTCTTTCTTTTTGTCGGTTTTACTGGAAAGGAAATACGGATGGGCAACAGG
ACATCCATGAACTTTATTTATGCTGTGGTCCTGAAAGAAAAAACAGAAGGAAATGCAATG
TGG

CDS

1713 bp

>Os04t0597600-01 TGF-beta receptor, type I/II extracellular region family protein.
ATGTTCTCCCCAAACTTTGAACTTGATCTGCAGAGCTGGAACCCGAAACTCCAGGACGAC
GTCAGCCTGACGGTGCCACTCATCCAGGACAAGAAGAGCGGGAGCAAAGCGCCGGCGGTG
GTGCTAGGATTCGAGTGCTTGGAGAGCACAGCGTTCAACGGCATTGCCACGAACCTGGTG
GTGTACCTGGAGACCGTCCTGCACGGCAGCAGCCTCGCGAGCGCGTCCAATGTCACGACG
TGGTTCGGCACGAGCTACCTCACGCCGGTGTTCGGCGCCATCATCGCCGACACGTTCTTC
GGCAACTACAACACCATCCTCGTCTCCCTCGTGTTCTACCTCCTGGGCATGGTGCTGGTC
ACCTTCTCGGCGTTCCTGCCGACCACCGCGCTGTGCGCCGTGGCGGGCTCGACGTCGTGC
CAGCAGCCTGTGTTTGGCGCGCAGACCATCGCCTTCGTGGGGCTCTACCTCGTGGCGTTC
GGCAGCGGCGGCGTGCGCGCGGCGCTGCTGCCGTTCGGCGCGGAGCAGTTCGACGACGAC
AACGCGGTGGACCGGGAGCGGAAGATGTCCTTCTTCAGCTGGTTCTACATGTGCGTCGAC
TTCGGGATGATCGTGTCGGGCCTATTCATCGTGTGGATCCAGCAGAACGTGAGCTGGGGA
CTCGGCTTCGGCATCGCCACGGTTTGCGTCGCGATCGCGTTCGGCGGCTTCGTGCTCGCC
ACGCCCATGTACAAGCGCAGCATGCCCACCGGCACGCCGCTCAAGAGCCTCGCCCAGGTG
GTGGTCGCCGCGTGCCGGAAGGTCAGCCTCCGTGTCCCCGCCGACGCCGCCCTCCTCTAC
GAGGTCCATGACAAGATCGATCAGCCCAAGATCACGCACACCGACGAGTTCAGCTTTCTT
GACAAGGCGGCGGTGATCGTGCAGTCCGACCTGGAAGAGGACTCGAACGACGCCTCGGCG
GCGGCCGCGGGCTCGTGGAGGCTATGCACGGTGACGCAGGTGGAGGAGCTCAAGATCCTG
ATGCGGCTGCTGCCGATATGGGCGACGAGCATCGTGCTGTCGGCGGCGTACGCGCAGCTG
AACACCACGTTCGTGCAGCAGGGCGCCGCGATGAACATGCGGATCATGTCGTTCACCATC
CCCGCCGCGTCGATGGTGTCCTTCGAGGTGTTCTGCGTCCTGGCATGGGTGCTCGTCTAC
GGCTCGGTGATCGTGCCGCTCCTCAGGAGCTTCTCCCCGGCCAACGGCGAGCCGTCGCAG
CTGCGGCGCATGGGCGCCGGCCGTCTGCTCATCGCGGTCGCCATGGCCATCGCCGCGCTG
GTGGAGATGGTGCGCCTCGACGCGGCGGCGCGCGGCGAGTCCCTGAGCATCGCGTGGCAG
ATGCCGCAGTACTTCATGCTGGCCGGCGGTGAGGTGTTCTGCTACATCGCGCAGCTGGAG
TTCTTCTACAGCGAGGCGCCGGAGTCCATGAAGAGCATCTGCACGTCGCTGGCGCTGCTC
ACCGTGGCGCTGGGAAGCTACATGAGCTCCTTCATCTACGCCGTCGTGAACGCGTTCACC
GCCGTGGACGGCCGGCCCGGGTGGATTTCGGACAACCTCAACGAGGGACACCTGGACTAC
TTCTTCTGGGTCATGTCGGCGCTGTGCACGCTCAACTTCGTCGTGTACAGCGCGTTCGCG
CGGAACTACAAGGTGAAGACGGTCGTGTCATGA

Protein

571 aa

>Os04t0597600-01 TGF-beta receptor, type I/II extracellular region family protein.
MFSPNFELDLQSWNPKLQDDVSLTVPLIQDKKSGSKAPAVVLGFECLESTAFNGIATNLV
VYLETVLHGSSLASASNVTTWFGTSYLTPVFGAIIADTFFGNYNTILVSLVFYLLGMVLV
TFSAFLPTTALCAVAGSTSCQQPVFGAQTIAFVGLYLVAFGSGGVRAALLPFGAEQFDDD
NAVDRERKMSFFSWFYMCVDFGMIVSGLFIVWIQQNVSWGLGFGIATVCVAIAFGGFVLA
TPMYKRSMPTGTPLKSLAQVVVAACRKVSLRVPADAALLYEVHDKIDQPKITHTDEFSFL
DKAAVIVQSDLEEDSNDASAAAAGSWRLCTVTQVEELKILMRLLPIWATSIVLSAAYAQL
NTTFVQQGAAMNMRIMSFTIPAASMVSFEVFCVLAWVLVYGSVIVPLLRSFSPANGEPSQ
LRRMGAGRLLIAVAMAIAALVEMVRLDAAARGESLSIAWQMPQYFMLAGGEVFCYIAQLE
FFYSEAPESMKSICTSLALLTVALGSYMSSFIYAVVNAFTAVDGRPGWISDNLNEGHLDY
FFWVMSALCTLNFVVYSAFARNYKVKTVVS*

5'UTR

chr04:30156252..30157189 (+ strand) : 938 bp

CDS

chr04:30157190..30158902 (+ strand) : 1713 bp

3'UTR

chr04:30158903..30159194 (+ strand) : 292 bp

FASTA

>Os04t0597600-01 class=Sequence position=chr04:30156252..30159194 (+ strand)
ATCTCTCGTG CTCAGCTCGC AGCCAAAAAC CCCAAGGCGC TCTCACGACG GCAGGAGCTA GCTTAGCTGC AGAAAAAGCA
GGTGACGTTG AATTCTGATT TCTGAACGAG TTGCAGCAGC ATAGCGACAA TGGACGCCGG CGACGCCATG GAGAGAGGCC
AGCAGCGGCT GCCAGAGGTA AGCATATGCA CAACTTCACA ACTATCTCGT TCTCCTCCTC TCACCGGTTT CGCTCATCAT
GAATTGATCT TTCTTAGTAC TCCAGTTTGC AACTTGGAAA CAAGCGATGG CAGTGAGAAT GCACGCATAT GGATCATAAC
TATAGCATAG TAATTTTCAG GCATGCTGTT ATTGGTTTCA CCTTCTTTAA ATTCAGAGTT CAGATTGAAG AATGGGTTGT
TATCAGGTTC ACCAAAATGA CAGAACAGAG GTGAATAGGT GAACGAAGGA AACAGTCATG GTCTACATCT ATGTGGTGCA
GTTGCACCAC TATTTGACCC TTTTCTACGC AAGATAGAGA ATAATGTTAC GGCTAAGACG AACCGTATCC AAACACACTA
TAGTCGTACG ACGTATTGGC ACGTTGCCAC GAGGGTGAGT TGGTGGCAAC ACACTCATTG GTCAGGTCTC CATGGTTAAA
ACGAGCGTGA AAAATTCTGA AGTCAGAAAA AATTAATAGT GTGTGTTTAA TACTAAGAAA TTTTGTCAGA CTTTTCACGC
ATAAGTTTAA AAAAAAGTTG GTCAGAAAAC TAAAGCAACA GAACACATAC ACACAAGTGC ACCACAACCA CCGTATACCT
TTCGTATTCA TCTGTACAAA GCTGCTTCCT TTATCCCTTT ACGATTTTCA AGTACAATCG CTGACGTCTA CAACAACGCC
GCAAAAACTT TGATGGCTTG TTCAGATATA CAAGAAATAA AAAAAAATGT AAACTGACAT GTTCTCCCCA AACTTTGAAC
TTGATCTGCA GAGCTGGAAC CCGAAACTCC AGGACGACGT CAGCCTGACG GTGCCACTCA TCCAGGACAA GAAGAGCGGG
AGCAAAGCGC CGGCGGTGGT GCTAGGATTC GAGTGCTTGG AGAGCACAGC GTTCAACGGC ATTGCCACGA ACCTGGTGGT
GTACCTGGAG ACCGTCCTGC ACGGCAGCAG CCTCGCGAGC GCGTCCAATG TCACGACGTG GTTCGGCACG AGCTACCTCA
CGCCGGTGTT CGGCGCCATC ATCGCCGACA CGTTCTTCGG CAACTACAAC ACCATCCTCG TCTCCCTCGT GTTCTACCTC
CTGGGCATGG TGCTGGTCAC CTTCTCGGCG TTCCTGCCGA CCACCGCGCT GTGCGCCGTG GCGGGCTCGA CGTCGTGCCA
GCAGCCTGTG TTTGGCGCGC AGACCATCGC CTTCGTGGGG CTCTACCTCG TGGCGTTCGG CAGCGGCGGC GTGCGCGCGG
CGCTGCTGCC GTTCGGCGCG GAGCAGTTCG ACGACGACAA CGCGGTGGAC CGGGAGCGGA AGATGTCCTT CTTCAGCTGG
TTCTACATGT GCGTCGACTT CGGGATGATC GTGTCGGGCC TATTCATCGT GTGGATCCAG CAGAACGTGA GCTGGGGACT
CGGCTTCGGC ATCGCCACGG TTTGCGTCGC GATCGCGTTC GGCGGCTTCG TGCTCGCCAC GCCCATGTAC AAGCGCAGCA
TGCCCACCGG CACGCCGCTC AAGAGCCTCG CCCAGGTGGT GGTCGCCGCG TGCCGGAAGG TCAGCCTCCG TGTCCCCGCC
GACGCCGCCC TCCTCTACGA GGTCCATGAC AAGATCGATC AGCCCAAGAT CACGCACACC GACGAGTTCA GCTTTCTTGA
CAAGGCGGCG GTGATCGTGC AGTCCGACCT GGAAGAGGAC TCGAACGACG CCTCGGCGGC GGCCGCGGGC TCGTGGAGGC
TATGCACGGT GACGCAGGTG GAGGAGCTCA AGATCCTGAT GCGGCTGCTG CCGATATGGG CGACGAGCAT CGTGCTGTCG
GCGGCGTACG CGCAGCTGAA CACCACGTTC GTGCAGCAGG GCGCCGCGAT GAACATGCGG ATCATGTCGT TCACCATCCC
CGCCGCGTCG ATGGTGTCCT TCGAGGTGTT CTGCGTCCTG GCATGGGTGC TCGTCTACGG CTCGGTGATC GTGCCGCTCC
TCAGGAGCTT CTCCCCGGCC AACGGCGAGC CGTCGCAGCT GCGGCGCATG GGCGCCGGCC GTCTGCTCAT CGCGGTCGCC
ATGGCCATCG CCGCGCTGGT GGAGATGGTG CGCCTCGACG CGGCGGCGCG CGGCGAGTCC CTGAGCATCG CGTGGCAGAT
GCCGCAGTAC TTCATGCTGG CCGGCGGTGA GGTGTTCTGC TACATCGCGC AGCTGGAGTT CTTCTACAGC GAGGCGCCGG
AGTCCATGAA GAGCATCTGC ACGTCGCTGG CGCTGCTCAC CGTGGCGCTG GGAAGCTACA TGAGCTCCTT CATCTACGCC
GTCGTGAACG CGTTCACCGC CGTGGACGGC CGGCCCGGGT GGATTTCGGA CAACCTCAAC GAGGGACACC TGGACTACTT
CTTCTGGGTC ATGTCGGCGC TGTGCACGCT CAACTTCGTC GTGTACAGCG CGTTCGCGCG GAACTACAAG GTGAAGACGG
TCGTGTCATG ATCGCTCGCC CACACGTCCG CGCGTACATA GGCAAAACAA GGTAGCGTTA GGAACGGGGT GCGTCCAGGA
AATACACGGG ACACGTCCGG TGCACCTGCG AAACGGTTTT TGTATCGCAG CGACCAATAT CTTCTGGCTG CTGCTGATCG
ACGCCATCGT GTTCCTTGTT GTTTATTGTT TCTTTCTTTT TGTCGGTTTT ACTGGAAAGG AAATACGGAT GGGCAACAGG
ACATCCATGA ACTTTATTTA TGCTGTGGTC CTGAAAGAAA AAACAGAAGG AAATGCAATG TGG