Os04t0597800-01

Locus

Os04g0597800

Description

TGF-beta receptor, type I/II extracellular region family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PTR6

CGSNL Gene Name

PROTEIN TRANSPORTER 6

Oryzabase Gene Symbol Synonym(s)

OsPTR6, OsNRT1;2, NRT1;2, OsNPF7.3, NPF7.3

Oryzabase Gene Name Synonym(s)

PTR/NRT1 transporter 6, nitrate transporter 1/peptide transporter family 7.3, PTR/NRT1 family 7.3, NITRATE TRANSPORTER 1/PEPTIDE TRANSPORTER 7.3

Transcript Evidence

AK101480 (DDBJ, Best hit)

Protein Evidence

Q7XNU6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oligopeptide transport (GO:0006857)

Cellular Component: membrane (GO:0016020)

Molecular Function: transporter activity (GO:0005215)

Functional domain (InterPro)

Oligopeptide transporter (IPR000109)

Major facilitator superfamily domain, general substrate transporter (IPR016196)

Full-length cDNA

J033041C01 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0597800-01)

RiceXPro (AK101480)

Others

Oryzabase (8914)

KEGG (Os04t0597800-01)

Transcript

2177 bp

>Os04t0597800-01 TGF-beta receptor, type I/II extracellular region family protein.
GGGGTTGGTGAGTTGGTCTGTTGGTGGCCGGGGCGCGGGCGCGCTTACCTGTTCTCCCTC
GCGTGGAGCTCTTTGACTACGCCCGCCAGCTGCGCGTGTGTATAACCTTGCTTGCTTGCC
TCTCACAGCCGAAGTCGCAGGCGCAGTCAGGAGCTATCGGGAAAACGGGATTTCCCCCAG
CTTTCCAAGGTTCGCGGGTCAATCTCGCAGTGATACTCCGGCGGCGGCAATGGACGCCGG
CGAAATCATCGTGGCCCAGCCATCGCCGCGGCTGTATAAGAGTTTGACTTTCCGGAGGAT
CGCGACGAAGGAAAGGACCATTCCCCAGGATGAAGAGATGAAGATTCGCAGCCCGAGGTT
CCAGGACGAAAGCCTCACTGCGCCATTTATACTAGACAAGAAAGCGAGGAGCAAAGCGCC
AACAGTGGTCCTAGGATTCGAGTGCTTGGAGAGCACAGCATTTAACGGCATTGCCACGAA
CCTGGTGGTGTACCTGGAGACTCTCCTGCACGGCAGCAATCTCGCGAGCGCGTCCAATGT
CACGACGTGGTTCGGGACGAGCTACCTCACCCCGGTGTTCGGCGCCATCATCGCCGACAC
GTTCTGGGGCAACTACAACACCATCCTCGTCTCCCTCGTCTTCTATCTCCTTGGTATGAT
GCTGGTCACCTTCTCGGCGTTCCTGCCGACCACCGCGCTGTGCACCGTGGTGGGCTCGTC
GTGCCAGCAGCCACTTCTTGGCGCGCAGACCATCGCCTTCCTCGGGCTCTACCTCGTGGC
GTTCGGAAGCGGCGGTGTGCGCGCGGCGCTGCTGCCGTTCGGCGCGGACCAGTTCGACGA
TGACAACACGGCCGACCGCGAGCGCAAGATGTCCTTCTTCAGCTGGTTCTACATCTGCGT
CGACTTCGGGATGATCGTGTCGGGCCTTTTCATCGTGTGGATCCAGCAGAACGTTAGCTG
GGGACTTGGCTTCGGCATCGCCACGGCCTGCATCGCGCTCGCCTTCGGCGGCTTCGTGCT
CGCCACGCCCATGTACAAGCGCCGCATGCCCACAGGCACGCCGATCAAGAGCCTCGCGCA
GGTCGTGGTTGCCGCGTGCCGGAAGGCAAGACTCCGTGTCCCCGCGGACACTACTCTTCT
CTACGAAGTCCATGACAAGATCAACCAGTCGAAGATAGCGCACACCGACCAGTTCGGCTT
TCTTGACAAGGCCGCGGTGGTCATGGAGTCCGACTTGGAAGAGGAATCGAACGACGTCGC
GGCGGATGCCTCGTGGAGGATCTGCACGGTGACGCAGGTCGAGGAGCTCAAGATCCTGCT
GCGGCTATTGCCGATATGGGCGACGAGTATCGTGCTTTCGGCGGCGTACGCGCAGCTGAA
CACGACGTTCGTGCAGCAGGGCGCCGCGATGAACATGCGGATCATGTCGTTCACCATCCC
GCCCGCGTCGATGGTGTCCTTCGAGGTGCTCTGCGTCCTGGCATGGGTTCTCATGTACAG
CTCCGTGATCGTGCCCATGCTCAACAGCTTATCCCTGGCCAACGGCGAGCCGTCGCAGCT
GCAGCGGATGGGCGCGGGGCGGCTGCTCATGGCGTTCGCGATGGCCGTCGCGGCGCTGGT
GGAGATGATGCGGCTGGACGCGGCGGGGCGCGGCGAGTCCCTGAGCATCGCGTGGCAGAT
GCCGCAGTACTTCGCGCTGGCCGGCGCGGAGGTGTTCTGCTACATCGCGCAGCTGGAGTT
CTTCTACAGCGAGGCGCCGGAGTCCATGAAGAGCATGTGCACGTCCCTGGCGCTGCTCAC
CGTGGCGCTGGGAAGCTACATGAGCTCATTCATCTACGCCGTCGTGAACGCGTTCACCGC
CGTGGACGGGCGGCCCGGGTGGATATCGGACAACCTCAACGAAGGACACATGGACTACTT
CTTCTGGGTCATGGCGGCGCTGTGCACGCTCAACTTCGTCGTGTACAGCGCGTTCGCCCG
GACCTACAGGGTGAAGCTGGTCGTGTCGTGATTGTTCGTTACTCCCTTACCATGATCAGG
TTACACGCAATCGTGGTCGTATTGTGTTACAGAAGAATCTTGTACTCCTAGCTAGCAATA
GCGACAGCCGACAGTATGTGTAAAGTTCAAGGAAAAAAAACAAGGTTTGATGGGCTGACA
GCCCAGCAGCTTCCTTT

CDS

1782 bp

>Os04t0597800-01 TGF-beta receptor, type I/II extracellular region family protein.
ATGGACGCCGGCGAAATCATCGTGGCCCAGCCATCGCCGCGGCTGTATAAGAGTTTGACT
TTCCGGAGGATCGCGACGAAGGAAAGGACCATTCCCCAGGATGAAGAGATGAAGATTCGC
AGCCCGAGGTTCCAGGACGAAAGCCTCACTGCGCCATTTATACTAGACAAGAAAGCGAGG
AGCAAAGCGCCAACAGTGGTCCTAGGATTCGAGTGCTTGGAGAGCACAGCATTTAACGGC
ATTGCCACGAACCTGGTGGTGTACCTGGAGACTCTCCTGCACGGCAGCAATCTCGCGAGC
GCGTCCAATGTCACGACGTGGTTCGGGACGAGCTACCTCACCCCGGTGTTCGGCGCCATC
ATCGCCGACACGTTCTGGGGCAACTACAACACCATCCTCGTCTCCCTCGTCTTCTATCTC
CTTGGTATGATGCTGGTCACCTTCTCGGCGTTCCTGCCGACCACCGCGCTGTGCACCGTG
GTGGGCTCGTCGTGCCAGCAGCCACTTCTTGGCGCGCAGACCATCGCCTTCCTCGGGCTC
TACCTCGTGGCGTTCGGAAGCGGCGGTGTGCGCGCGGCGCTGCTGCCGTTCGGCGCGGAC
CAGTTCGACGATGACAACACGGCCGACCGCGAGCGCAAGATGTCCTTCTTCAGCTGGTTC
TACATCTGCGTCGACTTCGGGATGATCGTGTCGGGCCTTTTCATCGTGTGGATCCAGCAG
AACGTTAGCTGGGGACTTGGCTTCGGCATCGCCACGGCCTGCATCGCGCTCGCCTTCGGC
GGCTTCGTGCTCGCCACGCCCATGTACAAGCGCCGCATGCCCACAGGCACGCCGATCAAG
AGCCTCGCGCAGGTCGTGGTTGCCGCGTGCCGGAAGGCAAGACTCCGTGTCCCCGCGGAC
ACTACTCTTCTCTACGAAGTCCATGACAAGATCAACCAGTCGAAGATAGCGCACACCGAC
CAGTTCGGCTTTCTTGACAAGGCCGCGGTGGTCATGGAGTCCGACTTGGAAGAGGAATCG
AACGACGTCGCGGCGGATGCCTCGTGGAGGATCTGCACGGTGACGCAGGTCGAGGAGCTC
AAGATCCTGCTGCGGCTATTGCCGATATGGGCGACGAGTATCGTGCTTTCGGCGGCGTAC
GCGCAGCTGAACACGACGTTCGTGCAGCAGGGCGCCGCGATGAACATGCGGATCATGTCG
TTCACCATCCCGCCCGCGTCGATGGTGTCCTTCGAGGTGCTCTGCGTCCTGGCATGGGTT
CTCATGTACAGCTCCGTGATCGTGCCCATGCTCAACAGCTTATCCCTGGCCAACGGCGAG
CCGTCGCAGCTGCAGCGGATGGGCGCGGGGCGGCTGCTCATGGCGTTCGCGATGGCCGTC
GCGGCGCTGGTGGAGATGATGCGGCTGGACGCGGCGGGGCGCGGCGAGTCCCTGAGCATC
GCGTGGCAGATGCCGCAGTACTTCGCGCTGGCCGGCGCGGAGGTGTTCTGCTACATCGCG
CAGCTGGAGTTCTTCTACAGCGAGGCGCCGGAGTCCATGAAGAGCATGTGCACGTCCCTG
GCGCTGCTCACCGTGGCGCTGGGAAGCTACATGAGCTCATTCATCTACGCCGTCGTGAAC
GCGTTCACCGCCGTGGACGGGCGGCCCGGGTGGATATCGGACAACCTCAACGAAGGACAC
ATGGACTACTTCTTCTGGGTCATGGCGGCGCTGTGCACGCTCAACTTCGTCGTGTACAGC
GCGTTCGCCCGGACCTACAGGGTGAAGCTGGTCGTGTCGTGA

Protein

594 aa

>Os04t0597800-01 TGF-beta receptor, type I/II extracellular region family protein.
MDAGEIIVAQPSPRLYKSLTFRRIATKERTIPQDEEMKIRSPRFQDESLTAPFILDKKAR
SKAPTVVLGFECLESTAFNGIATNLVVYLETLLHGSNLASASNVTTWFGTSYLTPVFGAI
IADTFWGNYNTILVSLVFYLLGMMLVTFSAFLPTTALCTVVGSSCQQPLLGAQTIAFLGL
YLVAFGSGGVRAALLPFGADQFDDDNTADRERKMSFFSWFYICVDFGMIVSGLFIVWIQQ
NVSWGLGFGIATACIALAFGGFVLATPMYKRRMPTGTPIKSLAQVVVAACRKARLRVPAD
TTLLYEVHDKINQSKIAHTDQFGFLDKAAVVMESDLEEESNDVAADASWRICTVTQVEEL
KILLRLLPIWATSIVLSAAYAQLNTTFVQQGAAMNMRIMSFTIPPASMVSFEVLCVLAWV
LMYSSVIVPMLNSLSLANGEPSQLQRMGAGRLLMAFAMAVAALVEMMRLDAAGRGESLSI
AWQMPQYFALAGAEVFCYIAQLEFFYSEAPESMKSMCTSLALLTVALGSYMSSFIYAVVN
AFTAVDGRPGWISDNLNEGHMDYFFWVMAALCTLNFVVYSAFARTYRVKLVVS*

5'UTR

chr04:30161452..30161680 (+ strand) : 229 bp

CDS

chr04:30161681..30161731 (+ strand) : 51 bp

chr04:30161903..30161965 (+ strand) : 63 bp

chr04:30163513..30163821 (+ strand) : 309 bp

chr04:30163912..30165270 (+ strand) : 1359 bp

3'UTR

chr04:30165271..30165436 (+ strand) : 166 bp

FASTA

>Os04t0597800-01 class=Sequence position=chr04:30161452..30165436 (+ strand)
GGGGTTGGTG AGTTGGTCTG TTGGTGGCCG GGGCGCGGGC GCGCTTACCT GTTCTCCCTC GCGTGGAGCT CTTTGACTAC
GCCCGCCAGC TGCGCGTGTG TATAACCTTG CTTGCTTGCC TCTCACAGCC GAAGTCGCAG GCGCAGTCAG GAGCTATCGG
GAAAACGGGA TTTCCCCCAG CTTTCCAAGG TTCGCGGGTC AATCTCGCAG TGATACTCCG GCGGCGGCAA TGGACGCCGG
CGAAATCATC GTGGCCCAGC CATCGCCGCG GCTGTATAAG GTATGTGAAA CTTCATGAGC GAGCTCGCCG TCGACCCAAG
CTTAGGGAGA TATAGGGATT GATATTATCG GTGCAGCAGT GCGTGATTAG TTGTTTAGTT TAGCTTGCTT CTTAATTTGA
GGGCTTTCAT TTGGAGTTTA TAATCTGATT GTTTGGATTG CTTTTGTGCA GAGTTTGACT TTCCGGAGGA TCGCGACGAA
GGAAAGGACC ATTCCCCAGG ATGAAGAGAT GAAGGTAAGC ACCTCTTGAT CACGTTTGAA CTCGTCCTCT GTTGTTAATT
AGTCATTAAC TTGCGTAGTT GTAGTCCGTA GTAATAGAAA AACTTGGCGG GCGGGGTGCG ATGTGTGATG ATCTGCTGCA
AGAACTGAGA AATTTTTGCG TCAAAAAGGA ACTGAGAAAT TTTTGGATAA TGGATCACAT AACTCGTCTT CTAAACTCTA
ATAAATGGAT GTATACGACC ATTTTGTGCA TTCGTTTTAG TAAAAAAAGC AGCTACACAT TGTTTTCTTG TTTTTGCTAG
TACTTTAATA TAGTATACAT GCTATATTGT TGGTTTATTA CGGATTCCAT TTTTCAGGTG TCCTATGGTA ATAATTTTCG
CAAGTGTTTT TTTTTGAATT CATCACTGCA GACAACAAGA AATATGATTT AATGGTCAAA TTGATTACCC TGCAAATTGT
GTTGTGACAA TAAAATGATA TTCTCAATTT CAAGAGGCCA GCATGCAATT TCTACTATCA TAAAATAGTG AAATTAATTG
ACCGTATCAA GAACTGTACA CAACTGTTAG GTTTTTCAAG TTATTGTACT AGACCGTATC CACCTGCCAG ATTTTTGTTC
TAAAAGCGTA ATTTATTTTA TATTAAGCTA TTATCAATAT CTCGATGCAA ATGTGTGTTC TTTTTTATTA AAAGATTCTT
TCACTAGGGA AAAACGTCCG GCCAATCAAT TTGTCCCAGC ATAGTCGCCC TATGGGCTAT TTTTATAGGC CTTAGGCAGC
CGTACGCCCT GTTGAAAAAA AAAAAGACTC CCAGCTCAAA CCCAGCCCAA AACATCTGTT AATTTGGTTT TACATGTAAA
ATCATTGGGA GCCCGTAGAT TCAGAAACAA AGGTCTCAAA TTGGATATTT TTCTTAATTT TTATATTATT TCATATTATT
TCTAAAAGAT TAAAAAATAA ATTACAGTTT TAAAGTTTTG CAAAAATTTA CTCCTCCCGC CCTACCGTAG AGCGATATAT
GTGACATGGC AATCCAGGGA GGGGGTGCCG TGGCAATTTT GCATAAATCG CCCTCCCCTA GGACGATTTA TTCTTGAGAA
GGAGCCATCT ATAAAATTGT CATGACGCAA AATTTAGTGA TGCATCGGGT GCGTTATGGC AATTTTACAA GGCTCCCACC
CGAGGAGAAA TCGCCTTCCT GTAAAGTGAT TTATCTTTCA AGGGGGCCAC CTACAAATTG TCACGGTATA CCTCCCACGG
GGTGCCATGC CACATAGATT GTCCTATTGT AAGGTGATTT ATAAGTCCAC TTTTCGATAT GTAAAATTTT AAAATGATAA
TTTATTTTTT AATTTTTTTT AAAAAAATAA ACAAATCCTC AAATTGTGCA ATCTTTtgag gccttatttc gttgcaaact
ttttcttcaa acttctaact tttctatcac atcaaaactt ttttacacac gtaaactttc aacttttcta tcacattgtt
ttaattttaa ccaaactttc aattttaacg taaactagac acatcctgaC TTCGTTCGCA GATTCGCAGC CCGAGGTTCC
AGGACGAAAG CCTCACTGCG CCATTTATAC TAGACAAGAA AGCGAGGAGC AAAGCGCCAA CAGTGGTCCT AGGATTCGAG
TGCTTGGAGA GCACAGCATT TAACGGCATT GCCACGAACC TGGTGGTGTA CCTGGAGACT CTCCTGCACG GCAGCAATCT
CGCGAGCGCG TCCAATGTCA CGACGTGGTT CGGGACGAGC TACCTCACCC CGGTGTTCGG CGCCATCATC GCCGACACGT
TCTGGGGCAA CTACAACACC ATCCTCGTCT CCCTCGTCTT CTATCTCCTT GTAAGCATCA ATGCATTTTG CAAGATAGTA
TGTTGAAATC CATATGTCCA ATGTGCTTAA TTAACTTTGC AATCCATCGT CTGTGTGCAG GGTATGATGC TGGTCACCTT
CTCGGCGTTC CTGCCGACCA CCGCGCTGTG CACCGTGGTG GGCTCGTCGT GCCAGCAGCC ACTTCTTGGC GCGCAGACCA
TCGCCTTCCT CGGGCTCTAC CTCGTGGCGT TCGGAAGCGG CGGTGTGCGC GCGGCGCTGC TGCCGTTCGG CGCGGACCAG
TTCGACGATG ACAACACGGC CGACCGCGAG CGCAAGATGT CCTTCTTCAG CTGGTTCTAC ATCTGCGTCG ACTTCGGGAT
GATCGTGTCG GGCCTTTTCA TCGTGTGGAT CCAGCAGAAC GTTAGCTGGG GACTTGGCTT CGGCATCGCC ACGGCCTGCA
TCGCGCTCGC CTTCGGCGGC TTCGTGCTCG CCACGCCCAT GTACAAGCGC CGCATGCCCA CAGGCACGCC GATCAAGAGC
CTCGCGCAGG TCGTGGTTGC CGCGTGCCGG AAGGCAAGAC TCCGTGTCCC CGCGGACACT ACTCTTCTCT ACGAAGTCCA
TGACAAGATC AACCAGTCGA AGATAGCGCA CACCGACCAG TTCGGCTTTC TTGACAAGGC CGCGGTGGTC ATGGAGTCCG
ACTTGGAAGA GGAATCGAAC GACGTCGCGG CGGATGCCTC GTGGAGGATC TGCACGGTGA CGCAGGTCGA GGAGCTCAAG
ATCCTGCTGC GGCTATTGCC GATATGGGCG ACGAGTATCG TGCTTTCGGC GGCGTACGCG CAGCTGAACA CGACGTTCGT
GCAGCAGGGC GCCGCGATGA ACATGCGGAT CATGTCGTTC ACCATCCCGC CCGCGTCGAT GGTGTCCTTC GAGGTGCTCT
GCGTCCTGGC ATGGGTTCTC ATGTACAGCT CCGTGATCGT GCCCATGCTC AACAGCTTAT CCCTGGCCAA CGGCGAGCCG
TCGCAGCTGC AGCGGATGGG CGCGGGGCGG CTGCTCATGG CGTTCGCGAT GGCCGTCGCG GCGCTGGTGG AGATGATGCG
GCTGGACGCG GCGGGGCGCG GCGAGTCCCT GAGCATCGCG TGGCAGATGC CGCAGTACTT CGCGCTGGCC GGCGCGGAGG
TGTTCTGCTA CATCGCGCAG CTGGAGTTCT TCTACAGCGA GGCGCCGGAG TCCATGAAGA GCATGTGCAC GTCCCTGGCG
CTGCTCACCG TGGCGCTGGG AAGCTACATG AGCTCATTCA TCTACGCCGT CGTGAACGCG TTCACCGCCG TGGACGGGCG
GCCCGGGTGG ATATCGGACA ACCTCAACGA AGGACACATG GACTACTTCT TCTGGGTCAT GGCGGCGCTG TGCACGCTCA
ACTTCGTCGT GTACAGCGCG TTCGCCCGGA CCTACAGGGT GAAGCTGGTC GTGTCGTGAT TGTTCGTTAC TCCCTTACCA
TGATCAGGTT ACACGCAATC GTGGTCGTAT TGTGTTACAG AAGAATCTTG TACTCCTAGC TAGCAATAGC GACAGCCGAC
AGTATGTGTA AAGTTCAAGG AAAAAAAACA AGGTTTGATG GGCTGACAGC CCAGCAGCTT CCTTT

Locus: Os04g0597800

Loading...

Locus: Os04g0597800

Loading...