Os04t0605300-01

Locus

Os04g0605300

Description

Leucine-rich repeat, typical subtype containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIRL1

Oryzabase Gene Name Synonym(s)

intracellular Ras-group-related LRR protein 1

Transcript Evidence

AK066546 (DDBJ, Best hit)

Protein Evidence

B6SU52 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Leucine-rich repeat (IPR001611)

Leucine-rich repeat, typical subtype (IPR003591)

Full-length cDNA

J013070L16 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0605300-01)

RiceXPro (AK066546)

Others

Oryzabase (14432)

KEGG (Os04t0605300-01)

Transcript

1502 bp

>Os04t0605300-01 Leucine-rich repeat, typical subtype containing protein.
ACACCATACATCCCGCGCCTTCTTCCTCCTCAGCTTTGCCGAGACCTCGTTGCCTCAAGC
CGTGTTGCGTGCTGCATGCTCTGAATTGAAGAACTCTCTTGAGCCTGACCAGGTATATCA
GAAGTGGAGAAGAAGATTGGAAGCATGAGGGAAATGGGAGAGAAGAGGAGGCGTGGACAC
CTTAACCCTGCTGGTTTTGCAGGAGGGTTGCATGATCATGAGGAGAAGAAGAACGAGGAG
CATAAGCTAGACATGAGTGGCATGTCCATGGATGCCCTCCCACACCTCACCATGTCTCTT
GGTCAAGTCACCATCTTGGATCTCTCTAACAACAATCTTGAGAGCATCCCGGAGTCAATA
ATCGCTCGGCTGCTGAACGTGGTGGTGCTGGACGTGCGGTCCAACCAGCTGAAATCGCTG
CCCAACTCCATCGGCTGCCTCTCCAAGCTCAAGGTCCTCAACGTCTCCGGCAACCTGCTC
GAGTCCCTCCCCAACACCATCGAGGAGTGCCGTGCGCTGGAGGAGCTGCACGCCAACTTC
AACGAGCTGACGAAGCTGCCGGACACGCTGGGGTTCGAGCTGCACAGCCTCCGGAAGCTG
TCGGTGAACTCCAACAAGCTGGCGCAGCTCCCCTCCTCGACGTCGCACATGACGGCGCTC
AGGGCGCTGGACGCCCGGCTCAACTGCCTCCGCGCGCTCCCCGACGGGCTCGAGAACCTC
GCCAACCTCGAGGCGCTCAACGTCAGCCAGAACTTCCAGTTCCTCCGGGAGCTCCCCTAC
GCCGTCGGCCTCCTCGCCTCGCTCCGGGAGCTCGACGTCAGCTACAACTCCATCGCCGCG
CTCCCGGACTCCATGGGCTGCCTCACCAAGCTCGCCAGGTTCAGCGCCGTCGGCAACCCG
CTGGTGTCCCCGCCCATGGACGTCGTGGAGCAGGGCCTGGACGCCATGCGCGCCTACCTC
ACCGCGAGGATGAACGGCGGCGACGGCAAGAGGAAGAAGAAGGCGTGGCTGCCCAAGCTG
GTCAAGTACAGCACCTTCACGGCGAGGATGACGCCCGGGCGCACCAGGGTGCACGAGAAC
ACGGAGGGCCTCCTCATGTCGGACTACCGGTCGCTCAACGGCATCGCCTCGCCGAGGTTC
CTCACCATGCTCTCGCCGCGCCGCCTCTTCTCGCCGCGGAGGAATTCGCCCAAGCATTGT
TGATATGGCCGATCCGATCCGCCTCTGCCTACTCTGTGTACTGGTTGCCTGTTTGCTTCA
GGGGTGTACTTCAGATGATGTCATGCTCTCGTACTTAATTAGGATAGATATGATGATGCT
GCTGCTGCTAGCTGCTACCGCTGCTGCAAGGTGTGTATATGTTCTCATGAAGAGGTTTGT
AGCTTCGCATACAGTATATAGCTCTACAATTTTTGTTTGACGTAAAAAATGCTGTAGTAC
AATCTAGAGCATTGATGTACATAACAAGGGTAATTTTCTTCCATGTCTGTTTGTTAAGCA
CC

CDS

1059 bp

>Os04t0605300-01 Leucine-rich repeat, typical subtype containing protein.
ATGAGGGAAATGGGAGAGAAGAGGAGGCGTGGACACCTTAACCCTGCTGGTTTTGCAGGA
GGGTTGCATGATCATGAGGAGAAGAAGAACGAGGAGCATAAGCTAGACATGAGTGGCATG
TCCATGGATGCCCTCCCACACCTCACCATGTCTCTTGGTCAAGTCACCATCTTGGATCTC
TCTAACAACAATCTTGAGAGCATCCCGGAGTCAATAATCGCTCGGCTGCTGAACGTGGTG
GTGCTGGACGTGCGGTCCAACCAGCTGAAATCGCTGCCCAACTCCATCGGCTGCCTCTCC
AAGCTCAAGGTCCTCAACGTCTCCGGCAACCTGCTCGAGTCCCTCCCCAACACCATCGAG
GAGTGCCGTGCGCTGGAGGAGCTGCACGCCAACTTCAACGAGCTGACGAAGCTGCCGGAC
ACGCTGGGGTTCGAGCTGCACAGCCTCCGGAAGCTGTCGGTGAACTCCAACAAGCTGGCG
CAGCTCCCCTCCTCGACGTCGCACATGACGGCGCTCAGGGCGCTGGACGCCCGGCTCAAC
TGCCTCCGCGCGCTCCCCGACGGGCTCGAGAACCTCGCCAACCTCGAGGCGCTCAACGTC
AGCCAGAACTTCCAGTTCCTCCGGGAGCTCCCCTACGCCGTCGGCCTCCTCGCCTCGCTC
CGGGAGCTCGACGTCAGCTACAACTCCATCGCCGCGCTCCCGGACTCCATGGGCTGCCTC
ACCAAGCTCGCCAGGTTCAGCGCCGTCGGCAACCCGCTGGTGTCCCCGCCCATGGACGTC
GTGGAGCAGGGCCTGGACGCCATGCGCGCCTACCTCACCGCGAGGATGAACGGCGGCGAC
GGCAAGAGGAAGAAGAAGGCGTGGCTGCCCAAGCTGGTCAAGTACAGCACCTTCACGGCG
AGGATGACGCCCGGGCGCACCAGGGTGCACGAGAACACGGAGGGCCTCCTCATGTCGGAC
TACCGGTCGCTCAACGGCATCGCCTCGCCGAGGTTCCTCACCATGCTCTCGCCGCGCCGC
CTCTTCTCGCCGCGGAGGAATTCGCCCAAGCATTGTTGA

Protein

353 aa

>Os04t0605300-01 Leucine-rich repeat, typical subtype containing protein.
MREMGEKRRRGHLNPAGFAGGLHDHEEKKNEEHKLDMSGMSMDALPHLTMSLGQVTILDL
SNNNLESIPESIIARLLNVVVLDVRSNQLKSLPNSIGCLSKLKVLNVSGNLLESLPNTIE
ECRALEELHANFNELTKLPDTLGFELHSLRKLSVNSNKLAQLPSSTSHMTALRALDARLN
CLRALPDGLENLANLEALNVSQNFQFLRELPYAVGLLASLRELDVSYNSIAALPDSMGCL
TKLARFSAVGNPLVSPPMDVVEQGLDAMRAYLTARMNGGDGKRKKKAWLPKLVKYSTFTA
RMTPGRTRVHENTEGLLMSDYRSLNGIASPRFLTMLSPRRLFSPRRNSPKHC*

5'UTR

chr04:30558282..30558393 (- strand) : 112 bp

chr04:30556872..30556903 (- strand) : 32 bp

CDS

chr04:30556674..30556871 (- strand) : 198 bp

chr04:30555858..30556027 (- strand) : 170 bp

chr04:30553336..30554026 (- strand) : 691 bp

3'UTR

chr04:30553037..30553335 (- strand) : 299 bp

FASTA

>Os04t0605300-01 class=Sequence position=chr04:30553037..30558393 (- strand)
ACACCATACA TCCCGCGCCT TCTTCCTCCT CAGCTTTGCC GAGACCTCGT TGCCTCAAGC CGTGTTGCGT GCTGCATGCT
CTGAATTGAA GAACTCTCTT GAGCCTGACC AGGTGAGAGC TTTGCTTTTG CTTTTCTGCT GCTTCGTGCT CAGTTCGTTT
GGTGGTTTTT TCCGGAGTAT TTGCATGCGG CCGCTAGAGT GATCTTGTTG AAGGTTTTTT TTTTTTCCTC TTGTTTTTGG
GGGTAATTTG GTATGAGGCT AGCTAGCTAG CTACTGGTTT TCTCTCCTGG ATTTCTTGCG ATGAGGGAGC GCGCGAGATA
CTGCTAATCT TTTGTGTCGG TTTTCCGGGG TTTCTCCTGC TAAGGATTCA TGTTCTCGGT AGCTCGTTGT TTTCCGCCAT
TTTGCTTGCG GTGATTCTAG CTGTAGTGGT TTCTAGCTCT ACTATAATAC tccctccgtt tcgaaatgtt tgacgccgtt
gacattttaa gcacatgttt gaccgttcgt cttattcaaa aaatttaagt aattattaat tcttttccta tcatttgatt
cattgttaaa tatattttca tgcaggcata taattttaca tatttcacaa aagtttttga ataagatgaa cggttaaata
tgtgctaaaa agtcaacggt gtcaaacatt tcgaaacgga gggagtaCCA TTTTACTTCC GTTCAAAAAA TAATAATACC
ATTTTACTTG GTTTCTTGAT ACAAGTATTC TGGCTTTGAA TGTTTTTGTT TAAAAAATAG ACACACAGAA AGTCAGAAAG
AGAACTTAAA TACCCTCGTC CTCTCCCTTG CTAGTGCAGG CTATTTTTAA TGAGTAATAT CCTTCTTTAG TTAGCTGTGT
GCTCTTCTAA TCTTGGTTTC AACGCTGTCT TTGGCGATGT AGAGAGGTTT TCTGTCAAGA ACTTGTGTCC AGTTTCTTGT
TCTTGATAAC CCATCTCGAG GGGTATCTAG CATATGATTT CTTTTACAGG AGCTAACAAA ATGATGTAAG CTACTCCGTA
CTATATATAT AACGTTGTTC TAGCTAGATT ATGAGAGGGT TGCCTAGCTA ATATGCCTAG GGTTAATTAT AACCTAGCTA
GAACAAGAAA TAGTTCAGTT AAAAACAATT AATCTTTTTC TATCCCTTCC ACTTCACCGT ACCCACATGC ATTATTGTTC
CACTTTGTAC GTACGCTCTC TAAGCTCGTT CTCTCTCTCA CCAAACTCTT TTTATCTTAG TCATGTTGTT TATTCTGACT
GCAACATGCA ATTAATGGTG GTCACCCCTT ATGTTCCCTT GTCAATATGG CTGTGTACTG GCCGTATGTC CCAATCCTAG
CAATAATCAG AAGCATGCCT CTTTGGCTTG GGCTCACATA ATTGTGAGAT GTACAGTGAT GTGCTAATTA TTGCTGATGT
TTCTTCTCTC CTACCTTACT AATGCATCAT TTTCTTGTCC CTTTGTCTAG GTATATCAGA AGTGGAGAAG AAGATTGGAA
GCATGAGGGA AATGGGAGAG AAGAGGAGGC GTGGACACCT TAACCCTGCT GGTTTTGCAG GAGGGTTGCA TGATCATGAG
GAGAAGAAGA ACGAGGAGCA TAAGCTAGAC ATGAGTGGCA TGTCCATGGA TGCCCTCCCA CACCTCACCA TGTCTCTTGG
TCAAGTCACC ATCTTGGATC TCTCTAACAA CAATCTTGAG GTAGATTTCA TATATACGTG GTTTAATTTT ATTACTACTA
CTTTTGATCT GGAAGCTAGC TAGATCACAT GCTTCTTTGT CTATCTATTC AGAGTATTAT AGTAATGGAT AACCAGCAAG
AACTTATCTT CAAACGGTGT ACGGTAGTTT TATATCTTGG TGATAAGTTA AGTCGAGCTG TATGAGATAA GCATGGCCTA
TATTATTAAT ACTACATGAG CCTAACTAGC CATGCATCCC TCTTCACAAT CTCTTGTTTT TTTGCCGTTT GGCTTGTCCT
CCTTAATTTT GTCATTTTCT AGGACGAAAA ATATCAAATA AGTGATGGCT TTGTAAGAGC CAAGAATATT CTGAAACCAT
GCATACGTAT ACCAGTAGGA TGAACTTTAA GTTTTATTAT GGGATGAACG GTATTAAAGA CGAAAATACC TGCAAGTTGC
AAACTTATCT CTCTATCTGT TTGACTTGGT GGGAGAAATG GTACTGCCTG CAGTACTGTA CCGGCAAAAA AGAACATGCA
GATTAATTGT GCGTATGCTC TGGTTGTACT AACCTTTTTT TACAGTTGAC AAAACTTCGG AGAAAGTAAA AAAAAATCCG
ATCTTTATAC GAGACTTAAA TTTCCTTCCG TTTTGGAAAA CCGCAGAGCA TCCCGGAGTC AATAATCGCT CGGCTGCTGA
ACGTGGTGGT GCTGGACGTG CGGTCCAACC AGCTGAAATC GCTGCCCAAC TCCATCGGCT GCCTCTCCAA GCTCAAGGTC
CTCAACGTCT CCGGCAACCT GCTCGAGTCC CTCCCCAACA CCATCGAGGA GTGCCGGTGA GCCACCGCCG CCTCTCCTAC
ATACCAATCA ACTACGGATT GATATTCTCC GACTTAAGTC ACATGAATTT AAGACACTGA TATGTGGGTC ATTTTTACTA
TGGATTCATA TGCCAGTGAC TCTAAAGTTA ACTGATAAGT CAGGGGATCT CAATCCTTAC TTGTCTCGTT CTAAAACATA
CTTCCTCTGT TTTATATTAT AATAACTAGC ATGGTGGCCC GCGCAGATTG CGCGGCTAGC ATCATTATAT TTTCTCTCAT
ATAATAGCAC ATATTTTTCT CATTATATTA TTAAAATATA TTACAATAAC AACATAATTT TAAATTTTGC AATAACTTTT
CAAAACTACT AATGTGTAAT AACTACtcta gtctcctctt ctaatatttc ttatttttaa attctgaatt tcagctattt
ctaaattgta tttctatatg gactatgctt ttttttttct ctgattaatg taagaatttc taggccatga gagcgaacgt
ggaggctcCt ttttattctg aattttagtt ggttttaaat tccaatataa actttatact ctacttctaa tattccttat
ttttaattcc aaatttcttt tttttttctt aattgtattt ctatatggac tctatactct acttctaata tttcttattt
ttaatttcga atttcggtta tttcctaatt gtatttctat atggactcta tactctactt ctaatatttc ttatttttaa
ttccgaattt tagttatttc ctaattgtat ttctatatgg actctagtct cctcttctaa tattccttat ttcttaattc
ctaatttcaa ctatttctaa attgtatttc tatatggact ctagtctcct cttctaatat tccttatttt ttaattccga
atttcaacta tttttaaatt gtatttctat atagactcta gtctcctctt ttaatattcc ttatttttta attatgaatt
tcagctattt ctaaattgta ttactatatg gactctgcct tttctttttc tctgattaat gtgagaattt ctaggtcatg
agagcgaacg tggaggctcc ttttttttct gaattttagt tagttttaaa ttcctataag gactctatac tctacttcta
atatttctta ttttttaatt ccgaaatttc tatttttttt cttaattata tttctatatg gactctatac tctacttcta
atattcctta tttttaattc aaaatttcta ttatttccta attgtatttc tatatggact ctatactcta cttctaatat
tccttatttt tagttccgaa tttctattat ttcctaattg tatttctata tggactctat actcttctta taatattcct
tatttttaat tccgaatttc aactatttct aaagtgtatt tctatatgga ctctagtctc ctcttctaat attccttatt
ttttaatttt taattccaga ttttagctat ttctaaattg tatttctata tggactctGT tttttctttt tctctgatta
atgtgagaat ttctaagcca tgagagcgaa cgtgaaggct tctttttcta ttcctttaat tatataatag atttctAGCA
TTGATATATA TGTTAATGAA TCTAGACATA TATATGTGTT TAAGTTCATC AACATTTATA TTAACATTTA TATGAATGTC
GGTAATGCTA AAAAGCCTTA TAATATGAAA CAGAGGGAGT ACTAAGTATT TCTAATTCAG TACATAGAAA TGCTTGATGT
TAAAACGGTG TTTACTAATG TTAGTTTTTT GAATTGACGT GTGGCAGTGC GCTGGAGGAG CTGCACGCCA ACTTCAACGA
GCTGACGAAG CTGCCGGACA CGCTGGGGTT CGAGCTGCAC AGCCTCCGGA AGCTGTCGGT GAACTCCAAC AAGCTGGCGC
AGCTCCCCTC CTCGACGTCG CACATGACGG CGCTCAGGGC GCTGGACGCC CGGCTCAACT GCCTCCGCGC GCTCCCCGAC
GGGCTCGAGA ACCTCGCCAA CCTCGAGGCG CTCAACGTCA GCCAGAACTT CCAGTTCCTC CGGGAGCTCC CCTACGCCGT
CGGCCTCCTC GCCTCGCTCC GGGAGCTCGA CGTCAGCTAC AACTCCATCG CCGCGCTCCC GGACTCCATG GGCTGCCTCA
CCAAGCTCGC CAGGTTCAGC GCCGTCGGCA ACCCGCTGGT GTCCCCGCCC ATGGACGTCG TGGAGCAGGG CCTGGACGCC
ATGCGCGCCT ACCTCACCGC GAGGATGAAC GGCGGCGACG GCAAGAGGAA GAAGAAGGCG TGGCTGCCCA AGCTGGTCAA
GTACAGCACC TTCACGGCGA GGATGACGCC CGGGCGCACC AGGGTGCACG AGAACACGGA GGGCCTCCTC ATGTCGGACT
ACCGGTCGCT CAACGGCATC GCCTCGCCGA GGTTCCTCAC CATGCTCTCG CCGCGCCGCC TCTTCTCGCC GCGGAGGAAT
TCGCCCAAGC ATTGTTGATA TGGCCGATCC GATCCGCCTC TGCCTACTCT GTGTACTGGT TGCCTGTTTG CTTCAGGGGT
GTACTTCAGA TGATGTCATG CTCTCGTACT TAATTAGGAT AGATATGATG ATGCTGCTGC TGCTAGCTGC TACCGCTGCT
GCAAGGTGTG TATATGTTCT CATGAAGAGG TTTGTAGCTT CGCATACAGT ATATAGCTCT ACAATTTTTG TTTGACGTAA
AAAATGCTGT AGTACAATCT AGAGCATTGA TGTACATAAC AAGGGTAATT TTCTTCCATG TCTGTTTGTT AAGCACC

Locus: Os04g0605300

Loading...

Locus: Os04g0605300

Loading...