Os04t0605300-02

Locus

Os04g0605300

Description

Leucine-rich repeat, typical subtype containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIRL1

Oryzabase Gene Name Synonym(s)

intracellular Ras-group-related LRR protein 1

Transcript Evidence

AK061732 (DDBJ, Best hit)

AK104574 (DDBJ, Best hit)

Protein Evidence

B6SU52 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Leucine-rich repeat (IPR001611)

Leucine-rich repeat, typical subtype (IPR003591)

Full-length cDNA

001-038-C05 (Online Clone Ordering)

006-306-H11 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0605300-02)

RiceXPro (AK061732)

Others

Oryzabase (14432)

KEGG (Os04t0605300-02)

Transcript

1338 bp

>Os04t0605300-02 Leucine-rich repeat, typical subtype containing protein.
ATGAGGGAAATGGGAGAGAAGAGGAGGCGTGGACACCTTAACCCTGCTGGTTTTGCAGGA
GGGTTGCATGATCATGAGGAGAAGAAGAACGAGGAGCATAAGCTAGACATGAGTGGCATG
TCCATGGATGCCCTCCCACACCTCACCATGTCTCTTGGTCAAGTCACCATCTTGGATCTC
TCTAACAACAATCTTGAGAGCATCCCGGAGTCAATAATCGCTCGGCTGCTGAACGTGGTG
GTGCTGGACGTGCGGTCCAACCAGCTGAAATCGCTGCCCAACTCCATCGGCTGCCTCTCC
AAGCTCAAGGTCCTCAACGTCTCCGGCAACCTGCTCGAGTCCCTCCCCAACACCATCGAG
GAGTGCCGTGCGCTGGAGGAGCTGCACGCCAACTTCAACGAGCTGACGAAGCTGCCGGAC
ACGCTGGGGTTCGAGCTGCACAGCCTCCGGAAGCTGTCGGTGAACTCCAACAAGCTGGCG
CAGCTCCCCTCCTCGACGTCGCACATGACGGCGCTCAGGGCGCTGGACGCCCGGCTCAAC
TGCCTCCGCGCGCTCCCCGACGGGCTCGAGAACCTCGCCAACCTCGAGGCGCTCAACGTC
AGCCAGAACTTCCAGTTCCTCCGGGAGCTCCCCTACGCCGTCGGCCTCCTCGCCTCGCTC
CGGGAGCTCGACGTCAGCTACAACTCCATCGCCGCGCTCCCGGACTCCATGGGCTGCCTC
ACCAAGCTCGCCAGGTTCAGCGCCGTCGGCAACCCGCTGGTGTCCCCGCCCATGGACGTC
GTGGAGCAGGGCCTGGACGCCATGCGCGCCTACCTCACCGCGAGGATGAACGGCGGCGAC
GGCAAGAGGAAGAAGAAGGCGTGGCTGCCCAAGCTGGTCAAGTACAGCACCTTCACGGCG
AGGATGACGCCCGGGCGCACCAGGGTGCACGAGAACACGGAGGGCCTCCTCATGTCGGAC
TACCGGTCGCTCAACGGCATCGCCTCGCCGAGGTTCCTCACCATGCTCTCGCCGCGCCGC
CTCTTCTCGCCGCGGAGGAATTCGCCCAAGCATTGTTGATATGGCCGATCCGATCCGCCT
CTGCCTACTCTGTGTACTGGTTGCCTGTTTGCTTCAGGGGTGTACTTCAGATGATGTCAT
GCTCTCGTACTTAATTAGGATAGATATGATGATGCTGCTGCTGCTAGCTGCTACCGCTGC
TGCAAGGTGTGTATATGTTCTCATGAAGAGGTTTGTAGCTTCGCATACAGTATATAGCTC
TACAATTTTTGTTTGACGTAAAAAATGCTGTAGTACAATCTAGAGCATTGATGTACATAA
CAAGGGTAATTTTCTTCC

CDS

1059 bp

>Os04t0605300-02 Leucine-rich repeat, typical subtype containing protein.
ATGAGGGAAATGGGAGAGAAGAGGAGGCGTGGACACCTTAACCCTGCTGGTTTTGCAGGA
GGGTTGCATGATCATGAGGAGAAGAAGAACGAGGAGCATAAGCTAGACATGAGTGGCATG
TCCATGGATGCCCTCCCACACCTCACCATGTCTCTTGGTCAAGTCACCATCTTGGATCTC
TCTAACAACAATCTTGAGAGCATCCCGGAGTCAATAATCGCTCGGCTGCTGAACGTGGTG
GTGCTGGACGTGCGGTCCAACCAGCTGAAATCGCTGCCCAACTCCATCGGCTGCCTCTCC
AAGCTCAAGGTCCTCAACGTCTCCGGCAACCTGCTCGAGTCCCTCCCCAACACCATCGAG
GAGTGCCGTGCGCTGGAGGAGCTGCACGCCAACTTCAACGAGCTGACGAAGCTGCCGGAC
ACGCTGGGGTTCGAGCTGCACAGCCTCCGGAAGCTGTCGGTGAACTCCAACAAGCTGGCG
CAGCTCCCCTCCTCGACGTCGCACATGACGGCGCTCAGGGCGCTGGACGCCCGGCTCAAC
TGCCTCCGCGCGCTCCCCGACGGGCTCGAGAACCTCGCCAACCTCGAGGCGCTCAACGTC
AGCCAGAACTTCCAGTTCCTCCGGGAGCTCCCCTACGCCGTCGGCCTCCTCGCCTCGCTC
CGGGAGCTCGACGTCAGCTACAACTCCATCGCCGCGCTCCCGGACTCCATGGGCTGCCTC
ACCAAGCTCGCCAGGTTCAGCGCCGTCGGCAACCCGCTGGTGTCCCCGCCCATGGACGTC
GTGGAGCAGGGCCTGGACGCCATGCGCGCCTACCTCACCGCGAGGATGAACGGCGGCGAC
GGCAAGAGGAAGAAGAAGGCGTGGCTGCCCAAGCTGGTCAAGTACAGCACCTTCACGGCG
AGGATGACGCCCGGGCGCACCAGGGTGCACGAGAACACGGAGGGCCTCCTCATGTCGGAC
TACCGGTCGCTCAACGGCATCGCCTCGCCGAGGTTCCTCACCATGCTCTCGCCGCGCCGC
CTCTTCTCGCCGCGGAGGAATTCGCCCAAGCATTGTTGA

Protein

353 aa

>Os04t0605300-02 Leucine-rich repeat, typical subtype containing protein.
MREMGEKRRRGHLNPAGFAGGLHDHEEKKNEEHKLDMSGMSMDALPHLTMSLGQVTILDL
SNNNLESIPESIIARLLNVVVLDVRSNQLKSLPNSIGCLSKLKVLNVSGNLLESLPNTIE
ECRALEELHANFNELTKLPDTLGFELHSLRKLSVNSNKLAQLPSSTSHMTALRALDARLN
CLRALPDGLENLANLEALNVSQNFQFLRELPYAVGLLASLRELDVSYNSIAALPDSMGCL
TKLARFSAVGNPLVSPPMDVVEQGLDAMRAYLTARMNGGDGKRKKKAWLPKLVKYSTFTA
RMTPGRTRVHENTEGLLMSDYRSLNGIASPRFLTMLSPRRLFSPRRNSPKHC*

CDS

chr04:30556674..30556871 (- strand) : 198 bp

chr04:30555858..30556027 (- strand) : 170 bp

chr04:30553336..30554026 (- strand) : 691 bp

3'UTR

chr04:30553057..30553335 (- strand) : 279 bp

FASTA

>Os04t0605300-02 class=Sequence position=chr04:30553057..30556871 (- strand)
ATGAGGGAAA TGGGAGAGAA GAGGAGGCGT GGACACCTTA ACCCTGCTGG TTTTGCAGGA GGGTTGCATG ATCATGAGGA
GAAGAAGAAC GAGGAGCATA AGCTAGACAT GAGTGGCATG TCCATGGATG CCCTCCCACA CCTCACCATG TCTCTTGGTC
AAGTCACCAT CTTGGATCTC TCTAACAACA ATCTTGAGGT AGATTTCATA TATACGTGGT TTAATTTTAT TACTACTACT
TTTGATCTGG AAGCTAGCTA GATCACATGC TTCTTTGTCT ATCTATTCAG AGTATTATAG TAATGGATAA CCAGCAAGAA
CTTATCTTCA AACGGTGTAC GGTAGTTTTA TATCTTGGTG ATAAGTTAAG TCGAGCTGTA TGAGATAAGC ATGGCCTATA
TTATTAATAC TACATGAGCC TAACTAGCCA TGCATCCCTC TTCACAATCT CTTGTTTTTT TGCCGTTTGG CTTGTCCTCC
TTAATTTTGT CATTTTCTAG GACGAAAAAT ATCAAATAAG TGATGGCTTT GTAAGAGCCA AGAATATTCT GAAACCATGC
ATACGTATAC CAGTAGGATG AACTTTAAGT TTTATTATGG GATGAACGGT ATTAAAGACG AAAATACCTG CAAGTTGCAA
ACTTATCTCT CTATCTGTTT GACTTGGTGG GAGAAATGGT ACTGCCTGCA GTACTGTACC GGCAAAAAAG AACATGCAGA
TTAATTGTGC GTATGCTCTG GTTGTACTAA CCTTTTTTTA CAGTTGACAA AACTTCGGAG AAAGTAAAAA AAAATCCGAT
CTTTATACGA GACTTAAATT TCCTTCCGTT TTGGAAAACC GCAGAGCATC CCGGAGTCAA TAATCGCTCG GCTGCTGAAC
GTGGTGGTGC TGGACGTGCG GTCCAACCAG CTGAAATCGC TGCCCAACTC CATCGGCTGC CTCTCCAAGC TCAAGGTCCT
CAACGTCTCC GGCAACCTGC TCGAGTCCCT CCCCAACACC ATCGAGGAGT GCCGGTGAGC CACCGCCGCC TCTCCTACAT
ACCAATCAAC TACGGATTGA TATTCTCCGA CTTAAGTCAC ATGAATTTAA GACACTGATA TGTGGGTCAT TTTTACTATG
GATTCATATG CCAGTGACTC TAAAGTTAAC TGATAAGTCA GGGGATCTCA ATCCTTACTT GTCTCGTTCT AAAACATACT
TCCTCTGTTT TATATTATAA TAACTAGCAT GGTGGCCCGC GCAGATTGCG CGGCTAGCAT CATTATATTT TCTCTCATAT
AATAGCACAT ATTTTTCTCA TTATATTATT AAAATATATT ACAATAACAA CATAATTTTA AATTTTGCAA TAACTTTTCA
AAACTACTAA TGTGTAATAA CTACtctagt ctcctcttct aatatttctt atttttaaat tctgaatttc agctatttct
aaattgtatt tctatatgga ctatgctttt ttttttctct gattaatgta agaatttcta ggccatgaga gcgaacgtgg
aggctcCttt ttattctgaa ttttagttgg ttttaaattc caatataaac tttatactct acttctaata ttccttattt
ttaattccaa atttcttttt tttttcttaa ttgtatttct atatggactc tatactctac ttctaatatt tcttattttt
aatttcgaat ttcggttatt tcctaattgt atttctatat ggactctata ctctacttct aatatttctt atttttaatt
ccgaatttta gttatttcct aattgtattt ctatatggac tctagtctcc tcttctaata ttccttattt cttaattcct
aatttcaact atttctaaat tgtatttcta tatggactct agtctcctct tctaatattc cttatttttt aattccgaat
ttcaactatt tttaaattgt atttctatat agactctagt ctcctctttt aatattcctt attttttaat tatgaatttc
agctatttct aaattgtatt actatatgga ctctgccttt tctttttctc tgattaatgt gagaatttct aggtcatgag
agcgaacgtg gaggctcctt ttttttctga attttagtta gttttaaatt cctataagga ctctatactc tacttctaat
atttcttatt ttttaattcc gaaatttcta ttttttttct taattatatt tctatatgga ctctatactc tacttctaat
attccttatt tttaattcaa aatttctatt atttcctaat tgtatttcta tatggactct atactctact tctaatattc
cttattttta gttccgaatt tctattattt cctaattgta tttctatatg gactctatac tcttcttata atattcctta
tttttaattc cgaatttcaa ctatttctaa agtgtatttc tatatggact ctagtctcct cttctaatat tccttatttt
ttaattttta attccagatt ttagctattt ctaaattgta tttctatatg gactctGTtt tttctttttc tctgattaat
gtgagaattt ctaagccatg agagcgaacg tgaaggcttc tttttctatt cctttaatta tataatagat ttctAGCATT
GATATATATG TTAATGAATC TAGACATATA TATGTGTTTA AGTTCATCAA CATTTATATT AACATTTATA TGAATGTCGG
TAATGCTAAA AAGCCTTATA ATATGAAACA GAGGGAGTAC TAAGTATTTC TAATTCAGTA CATAGAAATG CTTGATGTTA
AAACGGTGTT TACTAATGTT AGTTTTTTGA ATTGACGTGT GGCAGTGCGC TGGAGGAGCT GCACGCCAAC TTCAACGAGC
TGACGAAGCT GCCGGACACG CTGGGGTTCG AGCTGCACAG CCTCCGGAAG CTGTCGGTGA ACTCCAACAA GCTGGCGCAG
CTCCCCTCCT CGACGTCGCA CATGACGGCG CTCAGGGCGC TGGACGCCCG GCTCAACTGC CTCCGCGCGC TCCCCGACGG
GCTCGAGAAC CTCGCCAACC TCGAGGCGCT CAACGTCAGC CAGAACTTCC AGTTCCTCCG GGAGCTCCCC TACGCCGTCG
GCCTCCTCGC CTCGCTCCGG GAGCTCGACG TCAGCTACAA CTCCATCGCC GCGCTCCCGG ACTCCATGGG CTGCCTCACC
AAGCTCGCCA GGTTCAGCGC CGTCGGCAAC CCGCTGGTGT CCCCGCCCAT GGACGTCGTG GAGCAGGGCC TGGACGCCAT
GCGCGCCTAC CTCACCGCGA GGATGAACGG CGGCGACGGC AAGAGGAAGA AGAAGGCGTG GCTGCCCAAG CTGGTCAAGT
ACAGCACCTT CACGGCGAGG ATGACGCCCG GGCGCACCAG GGTGCACGAG AACACGGAGG GCCTCCTCAT GTCGGACTAC
CGGTCGCTCA ACGGCATCGC CTCGCCGAGG TTCCTCACCA TGCTCTCGCC GCGCCGCCTC TTCTCGCCGC GGAGGAATTC
GCCCAAGCAT TGTTGATATG GCCGATCCGA TCCGCCTCTG CCTACTCTGT GTACTGGTTG CCTGTTTGCT TCAGGGGTGT
ACTTCAGATG ATGTCATGCT CTCGTACTTA ATTAGGATAG ATATGATGAT GCTGCTGCTG CTAGCTGCTA CCGCTGCTGC
AAGGTGTGTA TATGTTCTCA TGAAGAGGTT TGTAGCTTCG CATACAGTAT ATAGCTCTAC AATTTTTGTT TGACGTAAAA
AATGCTGTAG TACAATCTAG AGCATTGATG TACATAACAA GGGTAATTTT CTTCC

Locus: Os04g0605300

Loading...

Locus: Os04g0605300

Loading...