Os04t0610400-01

Locus

Os04g0610400

Description

APETALA-2-like transcription Factor, Control of the abscisic acid (ABA)/gibberellin (GA) balance

RAP-DB Gene Symbol Synonym(s)

ERF77, OsAP2-39, OsERF#077, OsERF077, OsERF77, AP2/EREBP#149, AP2/EREBP149

RAP-DB Gene Name Synonym(s)

ETHYLENE RESPONSE FACTOR 77, APETALA-2-like transcription factor OsAP2-39, ethylene response factor 77, APETALA2/ethylene-responsive element binding protein 149

CGSNL Gene Symbol

ERF77

CGSNL Gene Name

ETHYLENE RESPONSE FACTOR 77

Oryzabase Gene Symbol Synonym(s)

OsAP2-39, OsERF#077, OsERF077, OsERF77, AP2/EREBP#149, AP2/EREBP149, DLN121, OsDLN121

Oryzabase Gene Name Synonym(s)

APETALA-2-like transcription factor OsAP2-39, ethylene response factor 77, APETALA2/ethylene-responsive element binding protein 149, DLN repressor 121, DLN motif protein 121

Transcript Evidence

NM_001060364

Protein Evidence

Q7XPL6

Literature

PMID: 20838584

Note

Manual Curation

November 20, 2015

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Functional domain (InterPro)

DNA-binding domain (IPR016177)

AP2/ERF domain (IPR001471)

Expression Databases

TENOR (Os04t0610400-00)

Others

Oryzabase (9699)

Transcript

991 bp

>Os04t0610400-01 APETALA-2-like transcription Factor, Control of the abscisic acid (ABA)/gibberellin (GA) balance
CCCCAAACTCCAACGCACCACCGGCGCCAAACCAACCACCCACCATCCACCGGTCGAACA
CTTGGCGCTCTCGCCCGCCTTAGCTCGCTCTGCTCGTGGTGCTCGACCCGAACAAGAACG
GACATGGCTCCCAGGAACGCCgccgaggccgtcgccgtcgccgtggcggagggcggagga
gccggcatggagcccaggttccgcggcgtgaggaagcgcccgtggggcaggtacgcggcg
gagatccgcgacccggccaggaaggcgcgggtgtggctcggcaccttcgacaccgccgag
gccgcggcgcgcgcctacgacagcgccgcgctccacttccgcgggcccaaggccaagacc
aacttccccgtcgccttcgcgcacgcccaccaccacgccccgccgccgccgctgcccaag
gcggcggcgctggccgtcgtcagcccgaccagcAGCACGGTCGAGTCGTCCTCCCGGGAC
ACGCCCGCCGCCGCCCCGGTGGCGGCCGCGGCCAAGGCCCAGGTGCCCGCCTCGCCTTCG
CTCGATCTGAGCCTCGGGATGTCGGCCATGGTGGCCGCCCAGCCGTTCCTGTTCCTCGAC
CCCAGGGTCGCGGTGACCGTGGCCGTCGCGGCACCGGTGCCTCGCCGGCCGGCCGTCGTC
AGCGTCAAGAAGGAGGTAGCTCGCCTGGACGAGCAGAGCGACACCGGCTCGTCGTCATCC
GTGGTGGACGCCTCGCCGGCCGTCGGCGTGGGGCTCGACCTGAACCTGCCGCCGCCGATC
GAGGAGGCGTAGGTTGCAGCGCCCGATGACGACGACAAGACCCCCCCACAAATCCCTCGT
AGAAAAGTCTAGAGCGACGTGTAATAGTAAGAGGTTAATCGTCCGTTTAATTGCCAGGAT
TGATCAACTAGGTGTACATAGATCGTGTCCTTTTTGCACGGGGAGATAGGTATGAGGAAA
AGGCTACTACTCCCGGTGTTACAGTTCCTTT

CDS

669 bp

>Os04t0610400-01 APETALA-2-like transcription Factor, Control of the abscisic acid (ABA)/gibberellin (GA) balance
ATGGCTCCCAGGAACGCCgccgaggccgtcgccgtcgccgtggcggagggcggaggagcc
ggcatggagcccaggttccgcggcgtgaggaagcgcccgtggggcaggtacgcggcggag
atccgcgacccggccaggaaggcgcgggtgtggctcggcaccttcgacaccgccgaggcc
gcggcgcgcgcctacgacagcgccgcgctccacttccgcgggcccaaggccaagaccaac
ttccccgtcgccttcgcgcacgcccaccaccacgccccgccgccgccgctgcccaaggcg
gcggcgctggccgtcgtcagcccgaccagcAGCACGGTCGAGTCGTCCTCCCGGGACACG
CCCGCCGCCGCCCCGGTGGCGGCCGCGGCCAAGGCCCAGGTGCCCGCCTCGCCTTCGCTC
GATCTGAGCCTCGGGATGTCGGCCATGGTGGCCGCCCAGCCGTTCCTGTTCCTCGACCCC
AGGGTCGCGGTGACCGTGGCCGTCGCGGCACCGGTGCCTCGCCGGCCGGCCGTCGTCAGC
GTCAAGAAGGAGGTAGCTCGCCTGGACGAGCAGAGCGACACCGGCTCGTCGTCATCCGTG
GTGGACGCCTCGCCGGCCGTCGGCGTGGGGCTCGACCTGAACCTGCCGCCGCCGATCGAG
GAGGCGTAG

Protein

223 aa

>Os04t0610400-01 APETALA-2-like transcription Factor, Control of the abscisic acid (ABA)/gibberellin (GA) balance
MAPRNAAEAVAVAVAEGGGAGMEPRFRGVRKRPWGRYAAEIRDPARKARVWLGTFDTAEA
AARAYDSAALHFRGPKAKTNFPVAFAHAHHHAPPPPLPKAAALAVVSPTSSTVESSSRDT
PAAAPVAAAAKAQVPASPSLDLSLGMSAMVAAQPFLFLDPRVAVTVAVAAPVPRRPAVVS
VKKEVARLDEQSDTGSSSSVVDASPAVGVGLDLNLPPPIEEA*

5'UTR

chr04:30939170..30939292 (+ strand) : 123 bp

CDS

chr04:30939293..30939961 (+ strand) : 669 bp

3'UTR

chr04:30939962..30940160 (+ strand) : 199 bp

FASTA

>Os04t0610400-01 class=Sequence position=chr04:30939170..30940160 (+ strand)
CCCCAAACTC CAACGCACCA CCGGCGCCAA ACCAACCACC CACCATCCAC CGGTCGAACA CTTGGCGCTC TCGCCCGCCT
TAGCTCGCTC TGCTCGTGGT GCTCGACCCG AACAAGAACG GACATGGCTC CCAGGAACGC Cgccgaggcc gtcgccgtcg
ccgtggcgga gggcggagga gccggcatgg agcccaggtt ccgcggcgtg aggaagcgcc cgtggggcag gtacgcggcg
gagatccgcg acccggccag gaaggcgcgg gtgtggctcg gcaccttcga caccgccgag gccgcggcgc gcgcctacga
cagcgccgcg ctccacttcc gcgggcccaa ggccaagacc aacttccccg tcgccttcgc gcacgcccac caccacgccc
cgccgccgcc gctgcccaag gcggcggcgc tggccgtcgt cagcccgacc agcAGCACGG TCGAGTCGTC CTCCCGGGAC
ACGCCCGCCG CCGCCCCGGT GGCGGCCGCG GCCAAGGCCC AGGTGCCCGC CTCGCCTTCG CTCGATCTGA GCCTCGGGAT
GTCGGCCATG GTGGCCGCCC AGCCGTTCCT GTTCCTCGAC CCCAGGGTCG CGGTGACCGT GGCCGTCGCG GCACCGGTGC
CTCGCCGGCC GGCCGTCGTC AGCGTCAAGA AGGAGGTAGC TCGCCTGGAC GAGCAGAGCG ACACCGGCTC GTCGTCATCC
GTGGTGGACG CCTCGCCGGC CGTCGGCGTG GGGCTCGACC TGAACCTGCC GCCGCCGATC GAGGAGGCGT AGGTTGCAGC
GCCCGATGAC GACGACAAGA CCCCCCCACA AATCCCTCGT AGAAAAGTCT AGAGCGACGT GTAATAGTAA GAGGTTAATC
GTCCGTTTAA TTGCCAGGAT TGATCAACTA GGTGTACATA GATCGTGTCC TTTTTGCACG GGGAGATAGG TATGAGGAAA
AGGCTACTAC TCCCGGTGTT ACAGTTCCTT T

Locus: Os04g0610400

Loading...

Locus: Os04g0610400

Loading...