Os04t0611800-00

Locus

Os04g0611800

Description

Terpenoid synthase domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

KS1

CGSNL Gene Name

ENT-KAURENE SYNTHASE 1

Oryzabase Gene Symbol Synonym(s)

OsKS1, KS1, KS1A, KSL1, OsKSL1, OsKS1A, OsKS1B, OsKS1C, Ks1, Os KS1, OsTPS26

Oryzabase Gene Name Synonym(s)

rice ent-kaurene synthase1, Ent-kaurene synthase 1, "Ent-kaur-16-ene synthase, chloroplastic", Kaurene synthase 1, Ent-kaurene synthase B, ent-kaurene synthase I, terpene synthase 26

Transcript Evidence

AY347877 (DDBJ, Best hit)

Protein Evidence

Q0JA82 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Molecular Function: magnesium ion binding (GO:0000287)

Molecular Function: lyase activity (GO:0016829)

Functional domain (InterPro)

Terpene synthase-like (IPR001906)

Terpene synthase, metal-binding domain (IPR005630)

Terpenoid cylases/protein prenyltransferase alpha-alpha toroid (IPR008930)

Terpenoid synthase (IPR008949)

Expression Databases

TENOR (Os04t0611800-00)

RiceXPro (AY347877)

Others

Oryzabase (3131)

KEGG (Os04t0611800-00)

Transcript

2283 bp

>Os04t0611800-00 Terpenoid synthase domain containing protein.
ATGCAGCACAGGAAGGAGCTCCAGGCAAGGACAAGGGACCAGCTCCAGACATTGGAGTTA
TCTACGTCTTTGTACGACACGGCGTGGGTGGCCATGGTGCCACTGCGGGGTTCCCGTCAG
CATCCGTGTTTCCCACAATGCGTGGAGTGGATATTACAAAACCAGCAGGATGATGGATCT
TGGGGTACAAGAGGATTCGGCGTGGCGGTCACAAGAGATGTTCTGTCGTCTACGTTGGCG
TGTGTTCTTGCACTCAAGAGATGGAATGTTGGGCAGGAGCACATCAGGAGAGGACTAGAT
TTTATTGGAAGGAATTTCTCCATTGCCATGGATGAGCAGATTGCTGCTCCTGTTGGTTTC
AACATCACTTTTCCTGGTATGCTTAGCCTTGCCATGGGGATGGATTTAGAATTCCCTGTC
AGACAGACGGATGTTGATAGACTTCTTCACCTCCGGGAGATAGAACTGGAAAGAGAGGCT
GGAGACCATTCTTATGGAAGAAAGGCATATATGGCTTATGTCACAGAAGGATTAGGAAAC
CTGTTGGAGTGGGATGAGATTATGATGTTCCAGAGGAAGAATGGATCATTTTTCAACTGT
CCTTCCACAACTGCTGCCACATTAGTCAACCACTATAACGATAAAGCCCTCCAGTACTTA
AATTGTCTGGTTAGTAAATTTGGCAGTGCAGTACCAACAGTGTATCCACTAAACATATAT
TGTCAGCTTTCATGGGTGGATGCACTTGAAAAGATGGGAATTTCTCAGTATTTTGTCAGT
GAGATAAAGAGCATCCTAGACACAACATACGTTTCATGGTTAGAAAGAGATGAGGAAATT
ATGCTGGACATAACAACATGTGCAATGGCTTTTCGCCTGTTAAGGATGAATGGGTATCAT
GTTTCCTCAGTCGAGTTATCTCCTGTTGCTGAAGCTTCCAGTTTCCGTGAATCACTTCAA
GGATATTTAAATGATAAGAAATCTCTAATCGAATTATACAAGGCTTCAAAAGTCAGTAAA
TCAGAAAATGAATCAATCTTAGATAGCATAGGCTCTTGGTCAGGTAGCTTATTGAAGGAA
AGTGTGTGCTCTAATGGGGTGAAAAAAGCTCCAATCTTTGAAGAGATGAAGTATGCTCTT
AAGTTTCCCTTCTACACCACACTGGACCGTCTAGATCACAAGAGGAACATTGAACGTTTT
GATGCAAAGGATTCCCAGATGTTAAAGACGGAATACTTGCTTCCTCATGCCAATCAAGAT
ATTCTAGCTTTGGCTGTTGAAGATTTCAGTAGTTCTCAATCTATATACCAGGATGAACTT
AATTATCTTGAGTGTTGGGTGAAAGATGAAAAGCTCGATCAGCTGCCATTTGCACGCCAG
AAGTTGACATATTGCTACCTTTCTGCTGCTGCTACCATATTCCCCCGTGAATTGTCTGAA
GCCCGCATTGCATGGGCTAAAAATGGTGTACTGACAACTGTTGTTGATGACTTCTTTGAT
CTTGGGGGATCAAAAGAAGAACTAGAAAACCTCATTGCTTTAGTTGAGAAGTGGGATGGA
CATCAAGAGGAGTTCTACTCAGAACAAGTAAGAATAGTTTTTTCTGCTATTTATACTACA
GTGAACCAGCTTGGAGCAAAGGCTTCTGCATTACAAGGCCGTGATGTTACAAAACACCTA
ACAGAAATATGGTTATGTCTGATGAGGTCTATGATGACCGAAGCTGAATGGCAGAGGACA
AAATATGTGCCGACAATGGAAGAATATATGGCAAATGCTGTTGTCTCATTTGCACTGGGA
CCTATTGTGCTCCCGACTCTGTATTTCGTAGGACCGAAGCTCCAAGAGGATGTCGTCAGG
GATCATGAGTACAATGAATTATTTAGACTGATGAGCACTTGTGGGCGTCTCCTGAATGAC
AGCCAAGGCTTTGAGAGGGAGAGCCTGGAGGGAAAGCTGAACAGTGTCTCACTGCTTGTT
CATCACAGTGGTGGTTCTATCTCCATAGACGAGGCTAAAATGAAAGCCCAGAAATCCATA
GACACTTCCAGGAGGAACTTGTTAAGATTGGTCCTTGGAGAACAGGGTGCTGTTCCTAGG
CCATGCAAGCAGCTGTTCTGGAAGATGTGCAAGATTGTTCACATGTTCTACTCTCGGACT
GATGGGTTTAGCTCGCCGAAGGAAATGGTTAGTGCAGTGAATGCAGTCGTCAAGGAGCCA
CTTAAACTCAAAGTGAGTGATCCATATGGCTCTATTTTGTCGGGCAATTGAGTGCTTCTC
CGT

CDS

2271 bp

>Os04t0611800-00 Terpenoid synthase domain containing protein.
ATGCAGCACAGGAAGGAGCTCCAGGCAAGGACAAGGGACCAGCTCCAGACATTGGAGTTA
TCTACGTCTTTGTACGACACGGCGTGGGTGGCCATGGTGCCACTGCGGGGTTCCCGTCAG
CATCCGTGTTTCCCACAATGCGTGGAGTGGATATTACAAAACCAGCAGGATGATGGATCT
TGGGGTACAAGAGGATTCGGCGTGGCGGTCACAAGAGATGTTCTGTCGTCTACGTTGGCG
TGTGTTCTTGCACTCAAGAGATGGAATGTTGGGCAGGAGCACATCAGGAGAGGACTAGAT
TTTATTGGAAGGAATTTCTCCATTGCCATGGATGAGCAGATTGCTGCTCCTGTTGGTTTC
AACATCACTTTTCCTGGTATGCTTAGCCTTGCCATGGGGATGGATTTAGAATTCCCTGTC
AGACAGACGGATGTTGATAGACTTCTTCACCTCCGGGAGATAGAACTGGAAAGAGAGGCT
GGAGACCATTCTTATGGAAGAAAGGCATATATGGCTTATGTCACAGAAGGATTAGGAAAC
CTGTTGGAGTGGGATGAGATTATGATGTTCCAGAGGAAGAATGGATCATTTTTCAACTGT
CCTTCCACAACTGCTGCCACATTAGTCAACCACTATAACGATAAAGCCCTCCAGTACTTA
AATTGTCTGGTTAGTAAATTTGGCAGTGCAGTACCAACAGTGTATCCACTAAACATATAT
TGTCAGCTTTCATGGGTGGATGCACTTGAAAAGATGGGAATTTCTCAGTATTTTGTCAGT
GAGATAAAGAGCATCCTAGACACAACATACGTTTCATGGTTAGAAAGAGATGAGGAAATT
ATGCTGGACATAACAACATGTGCAATGGCTTTTCGCCTGTTAAGGATGAATGGGTATCAT
GTTTCCTCAGTCGAGTTATCTCCTGTTGCTGAAGCTTCCAGTTTCCGTGAATCACTTCAA
GGATATTTAAATGATAAGAAATCTCTAATCGAATTATACAAGGCTTCAAAAGTCAGTAAA
TCAGAAAATGAATCAATCTTAGATAGCATAGGCTCTTGGTCAGGTAGCTTATTGAAGGAA
AGTGTGTGCTCTAATGGGGTGAAAAAAGCTCCAATCTTTGAAGAGATGAAGTATGCTCTT
AAGTTTCCCTTCTACACCACACTGGACCGTCTAGATCACAAGAGGAACATTGAACGTTTT
GATGCAAAGGATTCCCAGATGTTAAAGACGGAATACTTGCTTCCTCATGCCAATCAAGAT
ATTCTAGCTTTGGCTGTTGAAGATTTCAGTAGTTCTCAATCTATATACCAGGATGAACTT
AATTATCTTGAGTGTTGGGTGAAAGATGAAAAGCTCGATCAGCTGCCATTTGCACGCCAG
AAGTTGACATATTGCTACCTTTCTGCTGCTGCTACCATATTCCCCCGTGAATTGTCTGAA
GCCCGCATTGCATGGGCTAAAAATGGTGTACTGACAACTGTTGTTGATGACTTCTTTGAT
CTTGGGGGATCAAAAGAAGAACTAGAAAACCTCATTGCTTTAGTTGAGAAGTGGGATGGA
CATCAAGAGGAGTTCTACTCAGAACAAGTAAGAATAGTTTTTTCTGCTATTTATACTACA
GTGAACCAGCTTGGAGCAAAGGCTTCTGCATTACAAGGCCGTGATGTTACAAAACACCTA
ACAGAAATATGGTTATGTCTGATGAGGTCTATGATGACCGAAGCTGAATGGCAGAGGACA
AAATATGTGCCGACAATGGAAGAATATATGGCAAATGCTGTTGTCTCATTTGCACTGGGA
CCTATTGTGCTCCCGACTCTGTATTTCGTAGGACCGAAGCTCCAAGAGGATGTCGTCAGG
GATCATGAGTACAATGAATTATTTAGACTGATGAGCACTTGTGGGCGTCTCCTGAATGAC
AGCCAAGGCTTTGAGAGGGAGAGCCTGGAGGGAAAGCTGAACAGTGTCTCACTGCTTGTT
CATCACAGTGGTGGTTCTATCTCCATAGACGAGGCTAAAATGAAAGCCCAGAAATCCATA
GACACTTCCAGGAGGAACTTGTTAAGATTGGTCCTTGGAGAACAGGGTGCTGTTCCTAGG
CCATGCAAGCAGCTGTTCTGGAAGATGTGCAAGATTGTTCACATGTTCTACTCTCGGACT
GATGGGTTTAGCTCGCCGAAGGAAATGGTTAGTGCAGTGAATGCAGTCGTCAAGGAGCCA
CTTAAACTCAAAGTGAGTGATCCATATGGCTCTATTTTGTCGGGCAATTGA

Protein

757 aa

>Os04t0611800-00 Terpenoid synthase domain containing protein.
MQHRKELQARTRDQLQTLELSTSLYDTAWVAMVPLRGSRQHPCFPQCVEWILQNQQDDGS
WGTRGFGVAVTRDVLSSTLACVLALKRWNVGQEHIRRGLDFIGRNFSIAMDEQIAAPVGF
NITFPGMLSLAMGMDLEFPVRQTDVDRLLHLREIELEREAGDHSYGRKAYMAYVTEGLGN
LLEWDEIMMFQRKNGSFFNCPSTTAATLVNHYNDKALQYLNCLVSKFGSAVPTVYPLNIY
CQLSWVDALEKMGISQYFVSEIKSILDTTYVSWLERDEEIMLDITTCAMAFRLLRMNGYH
VSSVELSPVAEASSFRESLQGYLNDKKSLIELYKASKVSKSENESILDSIGSWSGSLLKE
SVCSNGVKKAPIFEEMKYALKFPFYTTLDRLDHKRNIERFDAKDSQMLKTEYLLPHANQD
ILALAVEDFSSSQSIYQDELNYLECWVKDEKLDQLPFARQKLTYCYLSAAATIFPRELSE
ARIAWAKNGVLTTVVDDFFDLGGSKEELENLIALVEKWDGHQEEFYSEQVRIVFSAIYTT
VNQLGAKASALQGRDVTKHLTEIWLCLMRSMMTEAEWQRTKYVPTMEEYMANAVVSFALG
PIVLPTLYFVGPKLQEDVVRDHEYNELFRLMSTCGRLLNDSQGFERESLEGKLNSVSLLV
HHSGGSISIDEAKMKAQKSIDTSRRNLLRLVLGEQGAVPRPCKQLFWKMCKIVHMFYSRT
DGFSSPKEMVSAVNAVVKEPLKLKVSDPYGSILSGN*

CDS

chr04:31027347..31027638 (+ strand) : 292 bp

chr04:31027748..31027928 (+ strand) : 181 bp

chr04:31028236..31028453 (+ strand) : 218 bp

chr04:31028540..31028660 (+ strand) : 121 bp

chr04:31028728..31028825 (+ strand) : 98 bp

chr04:31028948..31029162 (+ strand) : 215 bp

chr04:31029242..31029354 (+ strand) : 113 bp

chr04:31029434..31029529 (+ strand) : 96 bp

chr04:31029618..31029833 (+ strand) : 216 bp

chr04:31029944..31030082 (+ strand) : 139 bp

chr04:31030174..31030419 (+ strand) : 246 bp

chr04:31030692..31031027 (+ strand) : 336 bp

3'UTR

chr04:31031028..31031039 (+ strand) : 12 bp

FASTA

>Os04t0611800-00 class=Sequence position=chr04:31027347..31031039 (+ strand)
ATGCAGCACA GGAAGGAGCT CCAGGCAAGG ACAAGGGACC AGCTCCAGAC ATTGGAGTTA TCTACGTCTT TGTACGACAC
GGCGTGGGTG GCCATGGTGC CACTGCGGGG TTCCCGTCAG CATCCGTGTT TCCCACAATG CGTGGAGTGG ATATTACAAA
ACCAGCAGGA TGATGGATCT TGGGGTACAA GAGGATTCGG CGTGGCGGTC ACAAGAGATG TTCTGTCGTC TACGTTGGCG
TGTGTTCTTG CACTCAAGAG ATGGAATGTT GGGCAGGAGC ACATCAGGAG AGGTACAAAC GACTGTGCAT TTACCTGTCG
ATGTTTGTTT TAATTGACTC TGTATGTATC TACACATTTA AGGCTTGGAA TGTCTTAACG CTATGAAAAT GGTACTGTCA
GGACTAGATT TTATTGGAAG GAATTTCTCC ATTGCCATGG ATGAGCAGAT TGCTGCTCCT GTTGGTTTCA ACATCACTTT
TCCTGGTATG CTTAGCCTTG CCATGGGGAT GGATTTAGAA TTCCCTGTCA GACAGACGGA TGTTGATAGA CTTCTTCACC
TCCGGGAGAT AGAACTGGAA AGGTCTGTTA ATTCTAACAC GAACATGGAT ATTGTATGTC ATTAGTATTT GTATTACTGT
TGTTACGAGT ATGTAAAGTT AGTATGCAAG GGTTGATTGT GTGGATGAAG TTTTACCATC AGGCGTTCTA AAAATAACTG
TCAGCTTAGT TTTATTCCCT AGTTCCCCCT GCATTCTTTT TGAAGGAAGG AATATAATGA CCTTCTCCTC TCTTTTTTTC
CAAGATCCTA TATTTGGAGG AAATGATCAA TCTCGGTTTT AATAGTGCCT ATGAGTAACG CACTGAAAAT CTGATATGAT
TAAATGCAGA GAGGCTGGAG ACCATTCTTA TGGAAGAAAG GCATATATGG CTTATGTCAC AGAAGGATTA GGAAACCTGT
TGGAGTGGGA TGAGATTATG ATGTTCCAGA GGAAGAATGG ATCATTTTTC AACTGTCCTT CCACAACTGC TGCCACATTA
GTCAACCACT ATAACGATAA AGCCCTCCAG TACTTAAATT GTCTGGTTAG TAAATTTGGC AGTGCAGGTG AGTCTGCACG
CATTTTCTTG TCAAGAACTT TCTACAGTGT AGACTGCTCC TAAATACATA GTAATACATT TGGTCCATTG CAGTACCAAC
AGTGTATCCA CTAAACATAT ATTGTCAGCT TTCATGGGTG GATGCACTTG AAAAGATGGG AATTTCTCAG TATTTTGTCA
GTGAGATAAA GAGCATCCTA GACACAACAT ACGTGTAATG ACTTTGAGTA AGTATTTTAT CTATCTTTAA TAGTTCAAAC
TTAATTTTAG CTAGTTTGCA GTTCATGGTT AGAAAGAGAT GAGGAAATTA TGCTGGACAT AACAACATGT GCAATGGCTT
TTCGCCTGTT AAGGATGAAT GGGTATCATG TTTCCTCAGG TGTGTTCTAA GGCTTGAAAG GAATATTTTT TTTGTTGGTT
TCGAACTATA TTCTACCTTT GGTTTTCATT TAACATGCTG AATTATTTTT TATTTAACAT GCTAATTTAA ATGCGGTGCA
GTCGAGTTAT CTCCTGTTGC TGAAGCTTCC AGTTTCCGTG AATCACTTCA AGGATATTTA AATGATAAGA AATCTCTAAT
CGAATTATAC AAGGCTTCAA AAGTCAGTAA ATCAGAAAAT GAATCAATCT TAGATAGCAT AGGCTCTTGG TCAGGTAGCT
TATTGAAGGA AAGTGTGTGC TCTAATGGGG TGAAAAAAGC TCCAATCTTT GAAGAGGTGC TTGCATGAAG TTTTGAATTT
CCATTTCATT CGGAAGTTCA TTTTGTGTTT AAGTATATGC CTTTTGTGAT TTCAGATGAA GTATGCTCTT AAGTTTCCCT
TCTACACCAC ACTGGACCGT CTAGATCACA AGAGGAACAT TGAACGTTTT GATGCAAAGG ATTCCCAGAT GTTAAAGACG
GAATACTTGT AAGGTTTTCA TTGAAAAGGT CTGCCAATCT GAGTAATATA TATGTTAGGC ACCAATTCCA CTATGTTGTT
TACTCAGGCT TCCTCATGCC AATCAAGATA TTCTAGCTTT GGCTGTTGAA GATTTCAGTA GTTCTCAATC TATATACCAG
GATGAACTTA ATTATCTTGA GTGGTAGGTA ATCCAGCCTG CTGTCAATCT GTCATGTTAT GCTCCTTTAT TGTACTACCT
TGGATAAATT GCAAAATTTT GTTTGCGACA GTTGGGTGAA AGATGAAAAG CTCGATCAGC TGCCATTTGC ACGCCAGAAG
TTGACATATT GCTACCTTTC TGCTGCTGCT ACCATATTCC CCCGTGAATT GTCTGAAGCC CGCATTGCAT GGGCTAAAAA
TGGTGTACTG ACAACTGTTG TTGATGACTT CTTTGATCTT GGGGGATCAA AAGAAGAACT AGAAAACCTC ATTGCTTTAG
TTGAGAAGTA CGTACAATCC TAATTCATTC TATTCGATCT ATTTGTCTGG TCTTTTGTAA GTGGCGCTGG TTATGCACAG
CTAATTCATC TTCTCTGATT TGCAAATGGC TGTCTAGGTG GGATGGACAT CAAGAGGAGT TCTACTCAGA ACAAGTAAGA
ATAGTTTTTT CTGCTATTTA TACTACAGTG AACCAGCTTG GAGCAAAGGC TTCTGCATTA CAAGGCCGTG ATGTTACAAA
ACACCTAACA GAAATAGTGA GTCCCATCTC ATGGTTGATC TATTGATTCT GTGGTGAATA TTGCTCTGTT GCATAGTGTT
TAGTGATAAG CTCAAACTCA TCTGCAGTGG TTATGTCTGA TGAGGTCTAT GATGACCGAA GCTGAATGGC AGAGGACAAA
ATATGTGCCG ACAATGGAAG AATATATGGC AAATGCTGTT GTCTCATTTG CACTGGGACC TATTGTGCTC CCGACTCTGT
ATTTCGTAGG ACCGAAGCTC CAAGAGGATG TCGTCAGGGA TCATGAGTAC AATGAATTAT TTAGACTGAT GAGCACTTGT
GGGCGTCTCC TGAATGACAG CCAAGGCTTT GAGGTACCCG GATCCCTTTC TGTGACAAAC CTCCTTGTAT TCTCATATTT
CTACAAGATT TAGCATGTAA ATAAAATTTT CGGTTTTACT TGATGTTATA TGATTGCAGC TATCTCATTC TCTGCCCACA
AATTTGTTGA CTAATCTGTA TAAATGTGAT ACTAATTATG AACACTTTTA TTTTTCTGTT GAAGGATTAG GACGTGGCTA
CAGTTCGACC CAACTACCCA AAGCTTGCAA ACTTATTCTA ACAAATAATT TCTCTATTGC TGCAGAGGGA GAGCCTGGAG
GGAAAGCTGA ACAGTGTCTC ACTGCTTGTT CATCACAGTG GTGGTTCTAT CTCCATAGAC GAGGCTAAAA TGAAAGCCCA
GAAATCCATA GACACTTCCA GGAGGAACTT GTTAAGATTG GTCCTTGGAG AACAGGGTGC TGTTCCTAGG CCATGCAAGC
AGCTGTTCTG GAAGATGTGC AAGATTGTTC ACATGTTCTA CTCTCGGACT GATGGGTTTA GCTCGCCGAA GGAAATGGTT
AGTGCAGTGA ATGCAGTCGT CAAGGAGCCA CTTAAACTCA AAGTGAGTGA TCCATATGGC TCTATTTTGT CGGGCAATTG
AGTGCTTCTC CGT

Locus: Os04g0611800

Loading...

Locus: Os04g0611800

Loading...