Os04t0614100-00

Locus

Os04g0614100

Description

Transcription factor, MADS-box domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MADS31

CGSNL Gene Name

MADS BOX GENE 31

Oryzabase Gene Symbol Synonym(s)

OsMADS31

Oryzabase Gene Name Synonym(s)

MADS box gene31, MADS-box transcription factor 31

Transcript Evidence

AY177698 (DDBJ, Best hit)

Protein Evidence

Q84NC2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Transcription factor, MADS-box (IPR002100)

Transcription factor, K-box (IPR002487)

Expression Databases

TENOR (Os04t0614100-00)

RiceXPro (AY177698)

Others

Oryzabase (3096)

KEGG (Os04t0614100-00)

Transcript

561 bp

>Os04t0614100-00 Transcription factor, MADS-box domain containing protein.
ATGGGGCGTGGGAGAGTAGAGCTCAAAAAGATTGAAAATCCGACAAACCGCCAAGTTACC
TTCTCCAAGAGGAGGATGGGGCTGCTCAAGAAAGCAAATGAGCTGGCCATTCTTTGTGAT
GCACAAATTGGGGTGATTGTGTTCTCAGGCACTGGCAAGATGTACGAGTACTCCAGCCCC
CCTTGGAGGATTGCAAATATCTTTGATAGATACCTGAAAGCCCCCAGCACCCGTTTTGAG
GAGATGGATGTTCAGCAGAGAATCATCCAAGAGATGACAAGAATGAAGGATGAGAACAAC
AGGCTTAGGATCATCATGAGGCAGTATATGGGTGATGACTTGGCTTCACTGACTCTGCAA
GATGTGAGTAATCTTGAGCAGCAGATTGAGTTTTCTCTGTACAAAGTTCGTCTAAGGAAG
CAACAGCTACTTGATCAGCAGCTGCTTGAGATGCACAGCCGGGTATGTAACAAGAGGATA
TACCGGTTCAGTATTCTTCCCTACCTTATACACTATATTGAAATAATCAAGTTTTGATTG
CCCTCTTTCCATCCCAATAGG

CDS

537 bp

>Os04t0614100-00 Transcription factor, MADS-box domain containing protein.
ATGGGGCGTGGGAGAGTAGAGCTCAAAAAGATTGAAAATCCGACAAACCGCCAAGTTACC
TTCTCCAAGAGGAGGATGGGGCTGCTCAAGAAAGCAAATGAGCTGGCCATTCTTTGTGAT
GCACAAATTGGGGTGATTGTGTTCTCAGGCACTGGCAAGATGTACGAGTACTCCAGCCCC
CCTTGGAGGATTGCAAATATCTTTGATAGATACCTGAAAGCCCCCAGCACCCGTTTTGAG
GAGATGGATGTTCAGCAGAGAATCATCCAAGAGATGACAAGAATGAAGGATGAGAACAAC
AGGCTTAGGATCATCATGAGGCAGTATATGGGTGATGACTTGGCTTCACTGACTCTGCAA
GATGTGAGTAATCTTGAGCAGCAGATTGAGTTTTCTCTGTACAAAGTTCGTCTAAGGAAG
CAACAGCTACTTGATCAGCAGCTGCTTGAGATGCACAGCCGGGTATGTAACAAGAGGATA
TACCGGTTCAGTATTCTTCCCTACCTTATACACTATATTGAAATAATCAAGTTTTGA

Protein

178 aa

>Os04t0614100-00 Transcription factor, MADS-box domain containing protein.
MGRGRVELKKIENPTNRQVTFSKRRMGLLKKANELAILCDAQIGVIVFSGTGKMYEYSSP
PWRIANIFDRYLKAPSTRFEEMDVQQRIIQEMTRMKDENNRLRIIMRQYMGDDLASLTLQ
DVSNLEQQIEFSLYKVRLRKQQLLDQQLLEMHSRVCNKRIYRFSILPYLIHYIEIIKF*

CDS

chr04:31143100..31143287 (+ strand) : 188 bp

chr04:31143657..31143726 (+ strand) : 70 bp

chr04:31143800..31143961 (+ strand) : 162 bp

chr04:31144062..31144178 (+ strand) : 117 bp

3'UTR

chr04:31144179..31144202 (+ strand) : 24 bp

FASTA

>Os04t0614100-00 class=Sequence position=chr04:31143100..31144202 (+ strand)
ATGGGGCGTG GGAGAGTAGA GCTCAAAAAG ATTGAAAATC CGACAAACCG CCAAGTTACC TTCTCCAAGA GGAGGATGGG
GCTGCTCAAG AAAGCAAATG AGCTGGCCAT TCTTTGTGAT GCACAAATTG GGGTGATTGT GTTCTCAGGC ACTGGCAAGA
TGTACGAGTA CTCCAGCCCC CCTTGGAGGT ATGCATAAAG TTTTTTGTTT CAAGTATTGT CTGTCCTTTG CATTTGGTTT
TGTTTTGAGG CGAAATAGAA ATTTCAGACA TCGTTCATAA TACTTCTTGT TAAATTTCTT CGGTTTCTTC GATCAGTTCT
GCTCTATTCT ACAACTTTTC TATGATTTTT GGAACTTGTG TTGGAAAAAA TTGTTGATAA TATGCAATGT TTCATCATCA
TATTTTGAAC TGAATTATTA GTGATGAACT CAAGGGAATT TACAACTGAT TTTATACAAG TTTCTGCCAC CTACAGCCAT
TTCAACTTAG CTTAACCATG TGAAATTCTC GAAGAGAAAC CGATGATCAA ATACATAAAG TCTTTTCCTT TTGGCAGGAT
TGCAAATATC TTTGATAGAT ACCTGAAAGC CCCCAGCACC CGTTTTGAGG AGATGGATGT TCAGCAGGTA CACTGGTTCT
TGTAAACCAC TACCATAAGA TTTTACTTTC ATTAACCCAA AATCGTTCTT TGGCATAAAG AGAATCATCC AAGAGATGAC
AAGAATGAAG GATGAGAACA ACAGGCTTAG GATCATCATG AGGCAGTATA TGGGTGATGA CTTGGCTTCA CTGACTCTGC
AAGATGTGAG TAATCTTGAG CAGCAGATTG AGTTTTCTCT GTACAAAGTT CGTCTAAGGA AGGTAAAAAC AAAAACAACT
TGATGCAGTA GCTGTAGGTT CTGTTACTTG ACAAAACTCT GCATTCATCA CTGCTCATTG CTAACACCCT GATTTGTAGC
AGCAACAGCT ACTTGATCAG CAGCTGCTTG AGATGCACAG CCGGGTATGT AACAAGAGGA TATACCGGTT CAGTATTCTT
CCCTACCTTA TACACTATAT TGAAATAATC AAGTTTTGAT TGCCCTCTTT CCATCCCAAT AGG

Locus: Os04g0614100

Loading...

Locus: Os04g0614100

Loading...