Os04t0623300-01

Locus

Os04g0623300

Description

Polyamine oxidase, Seed germination

RAP-DB Gene Symbol Synonym(s)

PAO3, OsPAO3, OsAO3, AO3

RAP-DB Gene Name Synonym(s)

POLYAMINE OXIDASE 3, Polyamine oxidase 3, Amine oxidase 3

CGSNL Gene Symbol

PAO3

CGSNL Gene Name

POLYAMINE OXIDASE 3

Oryzabase Gene Symbol Synonym(s)

OsPAO3, OsAO3, AO3

Oryzabase Gene Name Synonym(s)

Polyamine oxidase 3, Amine oxidase 3

Transcript Evidence

AK064902

Protein Evidence

Q7X809

Literature

PMID: 21796433

PMID: 27570530

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

September 21, 2016

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Flavin amine oxidase (IPR001613)

FAD/NAD(P)-binding domain (IPR023753)

Amine oxidase (IPR002937)

Full-length cDNA

J013000L17 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0623300-01)

Others

Oryzabase (11404)

Transcript

2329 bp

>Os04t0623300-01 Polyamine oxidase, Seed germination
AGGATCCCGTCACCTCCAAAAGCCCAAAAAGCTCCCGAAACGCCAGGAAAGCGGAAGGTC
TCGTTCTCCTCCTCTCCCCAAAACCAAATCCCCCTCTCCGAAAATCTCCAAAAATCCAGC
GAAAACCATCCGATCCATCGATCGATCGATCGCCGCAAGACTGCTTCGGGTTTTTTTTTG
CTCTTGCTCCGATCGACTGCGTGCGCCTCGAATCGAAATCTCGAGTGATATCACGCGGGA
GTTGATCCAGACTTAAACCGGATTGCCTGAGAAGTTGATGGGATCGCGCGAATTCTCGGC
GCTGACGTGAGATCGTGAAAGGGTTGGACATCAAATTGCTAGGAGGTTGCGGCGATTTGG
CTGCACGACTGCATGAACTGTTTCGTGAACCTGGGACTCAACTCGAACTCGAACCACTAC
GTGGCCTGCCTCATCATCTTCCTGCTGCATTTCTCCCCGCAGTTTCTGTTAAATCCATCC
AATTGTAATTCGAATTCGAGTAGTAATCGTGAAGGAGAGAAACAGAACCCCAACAATGGC
GAACAACAGTTCATATGGTGAAAATGTTAGGAGAAAGTCCCACACACCTTCTGCTATTGT
TATCGGCAGTGGGTTTGCAGGCATTGCTGCAGCCAACGCTCTCAGGAATGCATCATTTGA
GGTTGTTCTTCTAGAATCTCGTGACAGGATAGGTGGTAGAATTCACACTGATTACTCTTT
TGGCTTTCCTGTTGATCTGGGAGCATCCTGGCTTCATGGTGTTTGTGAGGAAAATCCCCT
GGCACCAATTATTGGAAGGCTTGGACTTCCACTGTATCGCACAAGTGGAGATGACTCTGT
GCTGTTTGATCATGACCTTGAGAGTTATGCTCTCTATGACACTAAGGGCCATCAAGTTCC
CCAAGAGCTGGTAGAAAAGATAGGGAAGGTTTTTGAGACTATATTGGAAGAGACTGGCAA
ACTGAGGGAAGAAACTAAGGAAGACATTTCTATTGCGAAGGCCATTGCAATTGTTATGGA
GAGAAATCCACACTTGAGGCAAGAAGGGATTGCTCATGATGTTCTTCAGTGGTATTTGTG
CCGCATGGAAGGTTGGTTTGCTACTGATGCGGACGCAATCTCTCTTCAGGGTTGGGACCA
GGAGGTACTGCTTCCTGGTGGCCATGGTCTCATGGTTCGTGGATATCGTCCAGTAATAAA
TACTCTGGCAAAAGGCCTAGATATACGCCTTGGCCACAGGGTTGTTGAGATTGTTCGCCA
CAGGAATAGGGTGGAGGTTACTGTAAGCAGTGGTAAAACATTTGTTGCGGATGCTGCAGT
CATTGCTGTCCCCTTAGGTGTTCTTAAAGCAAACACCATTAAATTTGAACCTAGGCTGCC
AGAGTGGAAGGAGGAAGCAATAAGAGAACTCTCAGTTGGAGTCGAGAACAAAATAATTCT
CCACTTCAGCGAGGTTTTCTGGCCTAATGTGGAGTTCCTTGGAGTAGTTTCATCCACCAC
ATATGGCTGCAGCTATTTCCTCAACCTCCACAAGGCTACTGGCCATCCTGTTCTAGTTTA
CATGCCTGCGGGTCGGCTTGCATGTGACATTGAAAAGCTGTCAGATGAGGCTGCTGCCCA
ATTTGCCTTCTCTCAGCTGAAGAAGATCCTGCCCAACGCTGCCGAGCCGATACATTACCT
AGTGTCACATTGGGGCTCAGACGAGAATACACTTGGATCCTACACCTTCGATGGGGTGGG
CAAACCTCGTGACCTGTATGAGAAGCTGCGGATCCCAGTCGATAACCTATTCTTTGCTGG
AGAAGCCACCAGTGTCCAGTACACTGGCACGGTGCATGGCGCCTTCTCCACTGGTCTGAT
GGCAGCTGAGGAGTGCCGAATGAGGGTTCTTGAGCGGTTCAGGGAGCTGGACATGCTGGA
GATGTGCCACCCTGCAATGGGGGAGCAGACCGCCACTGTCTCAGTCCCACTGCTCATCTC
CCGGCTGTGAACAGACCAGGAGCTGCACAAAAATTATAGTCTTCTAAGGCCATTTGGCAC
TTGGCACCCGGCGAGCGCACTAAGCCATTCCCCTGATTGCTCGAGGAAGGCAGCATTGGA
GCAATTATCTTATTTGCTTCTCCTTGGCATGAGGAGTGTGCTGGTGCAGCTTGCGGTGCG
CTAAATAAAGTCACTGTGAAAATGGAGTGTGGGAGTCTGGTGTGTATTGTTGAGTATAAA
ATGAGGGAGTCAATATGTAGTTAAGCAGGGATTACGGACAATGTGAGCCATCATTACTGA
ACAAGATGGTGTATGTGTGACGAACAATTAATTTAAACGATCGATATTG

CDS

1455 bp

>Os04t0623300-01 Polyamine oxidase, Seed germination
ATGGCGAACAACAGTTCATATGGTGAAAATGTTAGGAGAAAGTCCCACACACCTTCTGCT
ATTGTTATCGGCAGTGGGTTTGCAGGCATTGCTGCAGCCAACGCTCTCAGGAATGCATCA
TTTGAGGTTGTTCTTCTAGAATCTCGTGACAGGATAGGTGGTAGAATTCACACTGATTAC
TCTTTTGGCTTTCCTGTTGATCTGGGAGCATCCTGGCTTCATGGTGTTTGTGAGGAAAAT
CCCCTGGCACCAATTATTGGAAGGCTTGGACTTCCACTGTATCGCACAAGTGGAGATGAC
TCTGTGCTGTTTGATCATGACCTTGAGAGTTATGCTCTCTATGACACTAAGGGCCATCAA
GTTCCCCAAGAGCTGGTAGAAAAGATAGGGAAGGTTTTTGAGACTATATTGGAAGAGACT
GGCAAACTGAGGGAAGAAACTAAGGAAGACATTTCTATTGCGAAGGCCATTGCAATTGTT
ATGGAGAGAAATCCACACTTGAGGCAAGAAGGGATTGCTCATGATGTTCTTCAGTGGTAT
TTGTGCCGCATGGAAGGTTGGTTTGCTACTGATGCGGACGCAATCTCTCTTCAGGGTTGG
GACCAGGAGGTACTGCTTCCTGGTGGCCATGGTCTCATGGTTCGTGGATATCGTCCAGTA
ATAAATACTCTGGCAAAAGGCCTAGATATACGCCTTGGCCACAGGGTTGTTGAGATTGTT
CGCCACAGGAATAGGGTGGAGGTTACTGTAAGCAGTGGTAAAACATTTGTTGCGGATGCT
GCAGTCATTGCTGTCCCCTTAGGTGTTCTTAAAGCAAACACCATTAAATTTGAACCTAGG
CTGCCAGAGTGGAAGGAGGAAGCAATAAGAGAACTCTCAGTTGGAGTCGAGAACAAAATA
ATTCTCCACTTCAGCGAGGTTTTCTGGCCTAATGTGGAGTTCCTTGGAGTAGTTTCATCC
ACCACATATGGCTGCAGCTATTTCCTCAACCTCCACAAGGCTACTGGCCATCCTGTTCTA
GTTTACATGCCTGCGGGTCGGCTTGCATGTGACATTGAAAAGCTGTCAGATGAGGCTGCT
GCCCAATTTGCCTTCTCTCAGCTGAAGAAGATCCTGCCCAACGCTGCCGAGCCGATACAT
TACCTAGTGTCACATTGGGGCTCAGACGAGAATACACTTGGATCCTACACCTTCGATGGG
GTGGGCAAACCTCGTGACCTGTATGAGAAGCTGCGGATCCCAGTCGATAACCTATTCTTT
GCTGGAGAAGCCACCAGTGTCCAGTACACTGGCACGGTGCATGGCGCCTTCTCCACTGGT
CTGATGGCAGCTGAGGAGTGCCGAATGAGGGTTCTTGAGCGGTTCAGGGAGCTGGACATG
CTGGAGATGTGCCACCCTGCAATGGGGGAGCAGACCGCCACTGTCTCAGTCCCACTGCTC
ATCTCCCGGCTGTGA

Protein

485 aa

>Os04t0623300-01 Polyamine oxidase, Seed germination
MANNSSYGENVRRKSHTPSAIVIGSGFAGIAAANALRNASFEVVLLESRDRIGGRIHTDY
SFGFPVDLGASWLHGVCEENPLAPIIGRLGLPLYRTSGDDSVLFDHDLESYALYDTKGHQ
VPQELVEKIGKVFETILEETGKLREETKEDISIAKAIAIVMERNPHLRQEGIAHDVLQWY
LCRMEGWFATDADAISLQGWDQEVLLPGGHGLMVRGYRPVINTLAKGLDIRLGHRVVEIV
RHRNRVEVTVSSGKTFVADAAVIAVPLGVLKANTIKFEPRLPEWKEEAIRELSVGVENKI
ILHFSEVFWPNVEFLGVVSSTTYGCSYFLNLHKATGHPVLVYMPAGRLACDIEKLSDEAA
AQFAFSQLKKILPNAAEPIHYLVSHWGSDENTLGSYTFDGVGKPRDLYEKLRIPVDNLFF
AGEATSVQYTGTVHGAFSTGLMAAEECRMRVLERFRELDMLEMCHPAMGEQTATVSVPLL
ISRL*

5'UTR

chr04:31674371..31674595 (- strand) : 225 bp

chr04:31673739..31674048 (- strand) : 310 bp

CDS

chr04:31673726..31673738 (- strand) : 13 bp

chr04:31671702..31671814 (- strand) : 113 bp

chr04:31671492..31671580 (- strand) : 89 bp

chr04:31671274..31671387 (- strand) : 114 bp

chr04:31671102..31671189 (- strand) : 88 bp

chr04:31670929..31671014 (- strand) : 86 bp

chr04:31670741..31670843 (- strand) : 103 bp

chr04:31670534..31670631 (- strand) : 98 bp

chr04:31670002..31670431 (- strand) : 430 bp

chr04:31669592..31669912 (- strand) : 321 bp

3'UTR

chr04:31669253..31669591 (- strand) : 339 bp

FASTA

>Os04t0623300-01 class=Sequence position=chr04:31669253..31674595 (- strand)
AGGATCCCGT CACCTCCAAA AGCCCAAAAA GCTCCCGAAA CGCCAGGAAA GCGGAAGGTC TCGTTCTCCT CCTCTCCCCA
AAACCAAATC CCCCTCTCCG AAAATCTCCA AAAATCCAGC GAAAACCATC CGATCCATCG ATCGATCGAT CGCCGCAAGA
CTGCTTCGGG TTTTTTTTTG CTCTTGCTCC GATCGACTGC GTGCGCCTCG AATCGAAATC TCGAGGTGGG TGTGTGGCGC
GATTTCGTAT AGCTTGCGTG CGATTTTTGG ACTGGGTTTG CGAGGGGAAA GATAGGGAGC CCTAGGTTTG TTGATTGCCT
TGGCTCGATT CGATCGCTTC TGGTGTGGGA TTCGGAGATT GGCTTCCTGA TGACTTAGGG GGTTGATTTT TGGTCTAGTT
TTAATCATCG GCTTTCTTGA ATCGCTTAAA TCTCTCGATT TTGCGGCGGA TTTCGTGTGC TGGGAAGCGG TTTTTGTGTG
ACTAAAACTG AAGGTTTATA AATTTGGGTG AATAATAAAC GGTTGGTTTC CTTTGATTTT TTCGCAGTGA TATCACGCGG
GAGTTGATCC AGACTTAAAC CGGATTGCCT GAGAAGTTGA TGGGATCGCG CGAATTCTCG GCGCTGACGT GAGATCGTGA
AAGGGTTGGA CATCAAATTG CTAGGAGGTT GCGGCGATTT GGCTGCACGA CTGCATGAAC TGTTTCGTGA ACCTGGGACT
CAACTCGAAC TCGAACCACT ACGTGGCCTG CCTCATCATC TTCCTGCTGC ATTTCTCCCC GCAGTTTCTG TTAAATCCAT
CCAATTGTAA TTCGAATTCG AGTAGTAATC GTGAAGGAGA GAAACAGAAC CCCAACAATG GCGAACAACA GTAAGTTCCT
GGCTTCGTTT GGCAGATTTT CTCATCCATT GTTTTTGTGG TGATTCTGTT GCTGATTTTT ATGTTATTTT GTTTATTCCA
TTATAAAGTC CCCCTCTCAG TTCAAGACTT TTTTTTTTTG CATCTGTTAA TGTAAAGTTA GGTGGAAAAT CGAATTTAGA
AGAAACTGTT TTATAAAGTT TGCTGATGTA TGCTAATACC TCTGCTAGTA GTAGAATATC GAACATGTAT TGTTTTAGGG
ATTTGTGCAC TTAATGCAAC CTTAGTGCAA AAACCGAAAT TTTCCACTCT CTAGGTGGTT GTAGTGATAA AATTGCTTTG
ATAATCTAAA CACACTGAGT TGCTTATGGT TGTTGGGAGG TGCCTAGTGG GCCAGATGAA AGAGACATCA GCCATCGTGG
ATGAGTTCCC ATATTCCTCT GTCGGTGGTA GGAAGAGAAA ACAAAACATT AGCTGTTTAC ACCTGTTGTA CCAGCGCCTC
AACCAATTGG AACCTTCTAG GGTTTTTCTC ATGGCGAGAG AAAGTCCTCC ATGTGGAGTT GTAGGCTCCT GCTGCGCCTT
TTAGTTCCTG AAGAGCTTGC AATTTGTAAG ACTCTAGTGT AAACCGTTCA TGCAAGCACT CACATACTGG TTGCAGTTGA
GGTCTAACAA CATGCAGATG CAGTAGTGCT TGAACTTTAA ATATCATATA CTTACTATTC TAAAATTAGA TCAGCAAAAG
TGCATGTCAT GTTAAGTTTA GTGCCATGCG GACATTCTAT GCATGCATGA TTCATATAGT ATTGTAATGC ATGTAGGGTG
CAGATTATTA TATGAGAATA TTCGCTGGTG GATCTAGTTA TCTAAGTTTC TTTATCTTCC AATGCCACCA TTTTCTTATT
TTACTGTTCA GCTCTTATAA AATGTTTTTT CTGTTGGCTT TCGTTGCTGT CTCATTTATG GATATCTTTA CTTTTGGATT
GTGCCTTTTA GTGCGCCTAT AGTCATTGTG TGAGATGTTC GGTGGCCATT ATTTTTTGCT TGTTAAGTGC TCTGAAGCAT
ATCCGGCAGA GGGTTGTCTC GCTAAAAGAT TGTCTAATTT ATAGTATGCC ACCAAATAAT TCCAAGATAA ACAGTATATA
GCCACAAATT CATGTCATGT CTATCGCCCA TTAGTCTGAA TTTGCACCAT GTCCACATAA CTAGAAAGAA CAGTACAATA
ATAATATTGT GTCCTTGCCT TTTGCACATC CTTTGAGGTC ATTGTGTTTT AACGGAGAGT CTTTGGTGTG CCTGCCCAGC
GAAAAATTTG ATCAGTCCTA CATCTCAGCT TCCAATGTGT AGCTACAGAC CAAGCGGtta ggtttctgtg gggaatcaac
agaatgttaa aattgtcctg tcttacctca ccatcattgt tctgagacag gggaacatgc ctcactacta accctccatg
atggaggggg tagaggaggg ttgatgtgag aagaacaggc gatatcggca atttcatcac ttggtaggct tctttatgtt
aattctgtat aaactgattt ttatcatttg gaggtaTAAA ACCCCCTTTC ACAATGAAGC AAACCGTTAG CCTTAAGGTG
CAAAACCTTT AGATTCATGA AACACAAGCA TCCATCCAAC TACATCAAAC ATGTGAAACT TTCAGGTTGC TTCCTGTGTT
GACAGTCATA TAAAGAACAT ATGATGGTAC ATGTGCCAGC CAGTATTTGC ACTTTAGATT TAAGCTGAAT GAGCTCCTTT
TTCAATGCAA TATTTTGGCA AGATAATAAC CAAAAATTGA CACATCATTA TTATTTTATA ATGTTTTAAC TTTTTATTAC
TACACTTTGT CACTCTCATT GAGGTTCCTT TTTTTTTTCC TTTTTTTTTT GTAAAATCCA GGTTCATATG GTGAAAATGT
TAGGAGAAAG TCCCACACAC CTTCTGCTAT TGTTATCGGC AGTGGGTTTG CAGGCATTGC TGCAGCCAAC GCTCTCAGGA
ATGCATCATT TGAGGTAATA TGTGATGCAG TTTATGGCCT AATTGTAATG ATATAGGTTC AATGATCCCT TGAAGTGCAT
TTCAAATGTT GTGAAATTCT TCCCCACTGG TTATTCTAAT GTGGTTTCTT TCCAGGTTGT TCTTCTAGAA TCTCGTGACA
GGATAGGTGG TAGAATTCAC ACTGATTACT CTTTTGGCTT TCCTGTTGAT CTGGGAGCAT CCTGGTGAGG TTCCTCTCTG
ACAATATTTT CTGAATTATT TGAAATGGTG GCAAAAGTTT ATCTGGAACC ATTATTTTTA ATCCACTTCC ATTTTGTGTG
AGCATCAGGC TTCATGGTGT TTGTGAGGAA AATCCCCTGG CACCAATTAT TGGAAGGCTT GGACTTCCAC TGTATCGCAC
AAGTGGAGAT GACTCTGTGC TGTTTGATCA TGACCTTGAG AGGTTACTAG AGCTAGTTTA TTTTGTATGT AACTTGAGAG
ATGATGGACC ATAATAATCA ACCATTTAAC ATGTTTTTTC CCTCAGTTAT GCTCTCTATG ACACTAAGGG CCATCAAGTT
CCCCAAGAGC TGGTAGAAAA GATAGGGAAG GTTTTTGAGA CTATATTGGA AGAGGTATTA CCTTGTTTCA GTTTCCATGC
TTATTGTTGT TGCATGATAA TATTTTTGGT ACTTGTTTTT CCCTAACATT TATATGTGCA GACTGGCAAA CTGAGGGAAG
AAACTAAGGA AGACATTTCT ATTGCGAAGG CCATTGCAAT TGTTATGGAG AGAAATCCAC ACTTGAGGTT TGTACCATCC
AATTTCTGCC CATGTGCATA GGTTATCCTG ATCTTTTGGT CATTTTGCCT GACCTGTCCT TGTTCACAAC AGGCAAGAAG
GGATTGCTCA TGATGTTCTT CAGTGGTATT TGTGCCGCAT GGAAGGTTGG TTTGCTACTG ATGCGGACGC AATCTCTCTT
CAGGGTTGGG ACCAGGTAGG ACTTTGGTTC CTGATATCAG CTACAATTGC CAATATTTTG CTCATGATGT ACTCATGCTA
GTTTGATTGC TATGTCTCAT GTTCGTACTG TGCTGTGGGT GCAGGAGGTA CTGCTTCCTG GTGGCCATGG TCTCATGGTT
CGTGGATATC GTCCAGTAAT AAATACTCTG GCAAAAGGCC TAGATATACG CCTTGGCCAC AGGTATGCAT ATCCATTTAG
TTTTTCCTTC TCACTTTAAA AGCAAAATTC ATGGTTCCAT CCACCATTCC TTATTGCTAA TCCACATTAT TTTCTTTTCT
TTAGGGTTGT TGAGATTGTT CGCCACAGGA ATAGGGTGGA GGTTACTGTA AGCAGTGGTA AAACATTTGT TGCGGATGCT
GCAGTCATTG CTGTCCCCTT AGGTGTTCTT AAAGCAAACA CCATTAAATT TGAACCTAGG CTGCCAGAGT GGAAGGAGGA
AGCAATAAGA GAACTCTCAG TTGGAGTCGA GAACAAAATA ATTCTCCACT TCAGCGAGGT TTTCTGGCCT AATGTGGAGT
TCCTTGGAGT AGTTTCATCC ACCACATATG GCTGCAGCTA TTTCCTCAAC CTCCACAAGG CTACTGGCCA TCCTGTTCTA
GTTTACATGC CTGCGGGTCG GCTTGCATGT GACATTGAAA AGCTGTCAGA TGAGGCTGCT GCCCAATTTG CCTTCTCTCA
GCTGAAGAAG ATCCTGCCCA ACGCTGCCGA GCCGGTTAGT ATCTTGACAA AAATATCAAA TTTGGCAATC AAGAATCTCT
TTATGCTAGT TCTTACAACC ATGCTGCCCA AATCTTATTG CAGATACATT ACCTAGTGTC ACATTGGGGC TCAGACGAGA
ATACACTTGG ATCCTACACC TTCGATGGGG TGGGCAAACC TCGTGACCTG TATGAGAAGC TGCGGATCCC AGTCGATAAC
CTATTCTTTG CTGGAGAAGC CACCAGTGTC CAGTACACTG GCACGGTGCA TGGCGCCTTC TCCACTGGTC TGATGGCAGC
TGAGGAGTGC CGAATGAGGG TTCTTGAGCG GTTCAGGGAG CTGGACATGC TGGAGATGTG CCACCCTGCA ATGGGGGAGC
AGACCGCCAC TGTCTCAGTC CCACTGCTCA TCTCCCGGCT GTGAACAGAC CAGGAGCTGC ACAAAAATTA TAGTCTTCTA
AGGCCATTTG GCACTTGGCA CCCGGCGAGC GCACTAAGCC ATTCCCCTGA TTGCTCGAGG AAGGCAGCAT TGGAGCAATT
ATCTTATTTG CTTCTCCTTG GCATGAGGAG TGTGCTGGTG CAGCTTGCGG TGCGCTAAAT AAAGTCACTG TGAAAATGGA
GTGTGGGAGT CTGGTGTGTA TTGTTGAGTA TAAAATGAGG GAGTCAATAT GTAGTTAAGC AGGGATTACG GACAATGTGA
GCCATCATTA CTGAACAAGA TGGTGTATGT GTGACGAACA ATTAATTTAA ACGATCGATA TTG

Locus: Os04g0623300

Loading...

Locus: Os04g0623300

Loading...