Os04t0623300-02

Locus

Os04g0623300

Description

Similar to H0215F08.3 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PAO3

CGSNL Gene Name

POLYAMINE OXIDASE 3

Oryzabase Gene Symbol Synonym(s)

OsPAO3, OsAO3, AO3

Oryzabase Gene Name Synonym(s)

Polyamine oxidase 3, Amine oxidase 3

Transcript Evidence

AK068767 (DDBJ, Best hit)

Protein Evidence

Q01KC7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Amine oxidase (IPR002937)

Full-length cDNA

J013168B07 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0623300-02)

RiceXPro (AK068767)

Others

Oryzabase (11404)

KEGG (Os04t0623300-02)

Transcript

3528 bp

>Os04t0623300-02 Similar to H0215F08.3 protein.
GTGCACTTAATGCAACCTTAGTGCAAAAACCGAAATTTTCCACTCTCTAGGTGGTTGTAG
TGATAAAATTGCTTTGATAATCTAAACACACTGAGTTGCTTATGGTTGTTGGGAGGTGCC
TAGTGGGCCAGATGAAAGAGACATCAGCCATCGTGGATGAGTTCCCATATTCCTCTGTCG
GTGGTAGGAAGAGAAAACAAAACATTAGCTGTTTACACCTGTTGTACCAGCGCCTCAACC
AATTGGAACCTTCTAGGGTTTTTCTCATGGCGAGAGAAAGTCCTCCATGTGGAGTTGTAG
GCTCCTGCTGCGCCTTTTAGTTCCTGAAGAGCTTGCAATTTGTAAGACTCTAGTGTAAAC
CGTTCATGCAAGCACTCACATACTGGTTGCAGTTGAGGTCTAACAACATGCAGATGCAGT
AGTGCTTGAACTTTAAATATCATATACTTACTATTCTAAAATTAGATCAGCAAAAGTGCA
TGTCATGTTAAGTTTAGTGCCATGCGGACATTCTATGCATGCATGATTCATATAGTATTG
TAATGCATGTAGGGTGCAGATTATTATATGAGAATATTCGCTGGTGGATCTAGTTATCTA
AGTTTCTTTATCTTCCAATGCCACCATTTTCTTATTTTACTGTTCAGCTCTTATAAAATG
TTTTTTCTGTTGGCTTTCGTTGCTGTCTCATTTATGGATATCTTTACTTTTGGATTGTGC
CTTTTAGTGCGCCTATAGTCATTGTGTGAGATGTTCGGTGGCCATTATTTTTTGCTTGTT
AAGTGCTCTGAAGCATATCCGGCAGAGGGTTGTCTCGCTAAAAGATTGTCTAATTTATAG
TATGCCACCAAATAATTCCAAGATAAACAGTATATAGCCACAAATTCATGTCATGTCTAT
CGCCCATTAGTCTGAATTTGCACCATGTCCACATAACTAGAAAGAACAGTACAATAATAA
TATTGTGTCCTTGCCTTTTGCACATCCTTTGAGGTCATTGTGTTTTAACGGAGAGTCTTT
GGTGTGCCTGCCCAGCGAAAAATTTGATCAGTCCTACATCTCAGCTTCCAATGTGTAGCT
ACAGACCAAGCGGttaggtttctgtggggaatcaacagaatgttaaaattgtcctgtctt
acctcaccatcattgttctgagacaggggaacatgcctcactactaaccctccatgatgg
agggggtagaggagggttgatgtgagaagaacaggcgatatcggcaatttcatcacttgg
taggcttctttatgttaattctgtataaactgatttttatcatttggaggtaTAAAACCC
CCTTTCACAATGAAGCAAACCGTTAGCCTTAAGGTGCAAAACCTTTAGATTCATGAAACA
CAAGCATCCATCCAACTACATCAAACATGTGAAACTTTCAGGTTGCTTCCTGTGTTGACA
GTCATATAAAGAACATATGATGGTACATGTGCCAGCCAGTATTTGCACTTTAGATTTAAG
CTGAATGAGCTCCTTTTTCAATGCAATATTTTGGCAAGATAATAACCAAAAATTGACACA
TCATTATTATTTTATAATGTTTTAACTTTTTATTACTACACTTTGTCACTCTCATTGAGG
TTCCTTTTTTTTTTCCTTTTTTTTTTGTAAAATCCAGGTTCATATGGTGAAAATGTTAGG
AGAAAGTCCCACACACCTTCTGCTATTGTTATCGGCAGTGGGTTTGCAGGCATTGCTGCA
GCCAACGCTCTCAGGAATGCATCATTTGAGGTTGTTCTTCTAGAATCTCGTGACAGGATA
GGTGGTAGAATTCACACTGATTACTCTTTTGGCTTTCCTGTTGATCTGGGAGCATCCTGG
CTTCATGGTGTTTGTGAGGAAAATCCCCTGGCACCAATTATTGGAAGGCTTGGACTTCCA
CTGTATCGCACAAGTGGAGATGACTCTGTGCTGTTTGATCATGACCTTGAGAGGTTACTA
GAGCTAGTTTATTTTGTATGTAACTTGAGAGATGATGGACCATAATAATCAACCATTTAA
CATGTTTTTTCCCTCAGTTATGCTCTCTATGACACTAAGGGCCATCAAGTTCCCCAAGAG
CTGGTAGAAAAGATAGGGAAGGTTTTTGAGACTATATTGGAAGAGACTGGCAAACTGAGG
GAAGAAACTAAGGAAGACATTTCTATTGCGAAGGCCATTGCAATTGTTATGGAGAGAAAT
CCACACTTGAGGCAAGAAGGGATTGCTCATGATGTTCTTCAGTGGTATTTGTGCCGCATG
GAAGGTTGGTTTGCTACTGATGCGGACGCAATCTCTCTTCAGGGTTGGGACCAGGAGGTA
CTGCTTCCTGGTGGCCATGGTCTCATGGTTCGTGGATATCGTCCAGTAATAAATACTCTG
GCAAAAGGCCTAGATATACGCCTTGGCCACAGGGTTGTTGAGATTGTTCGCCACAGGAAT
AGGGTGGAGGTTACTGTAAGCAGTGGTAAAACATTTGTTGCGGATGCTGCAGTCATTGCT
GTCCCCTTAGGTGTTCTTAAAGCAAACACCATTAAATTTGAACCTAGGCTGCCAGAGTGG
AAGGAGGAAGCAATAAGAGAACTCTCAGTTGGAGTCGAGAACAAAATAATTCTCCACTTC
AGCGAGGTTTTCTGGCCTAATGTGGAGTTCCTTGGAGTAGTTTCATCCACCACATATGGC
TGCAGCTATTTCCTCAACCTCCACAAGGCTACTGGCCATCCTGTTCTAGTTTACATGCCT
GCGGGTCGGCTTGCATGTGACATTGAAAAGCTGTCAGATGAGGCTGCTGCCCAATTTGCC
TTCTCTCAGCTGAAGAAGATCCTGCCCAACGCTGCCGAGCCGATACATTACCTAGTGTCA
CATTGGGGCTCAGACGAGAATACACTTGGATCCTACACCTTCGATGGGGTGGGCAAACCT
CGTGACCTGTATGAGAAGCTGCGGATCCCAGTCGATAACCTATTCTTTGCTGGAGAAGCC
ACCAGTGTCCAGTACACTGGCACGGTGCATGGCGCCTTCTCCACTGGTCTGATGGCAGCT
GAGGAGTGCCGAATGAGGGTTCTTGAGCGGTTCAGGGAGCTGGACATGCTGGAGATGTGC
CACCCTGCAATGGGGGAGCAGACCGCCACTGTCTCAGTCCCACTGCTCATCTCCCGGCTG
TGAACAGACCAGGAGCTGCACAAAAATTATAGTCTTCTAAGGCCATTTGGCACTTGGCAC
CCGGCGAGCGCACTAAGCCATTCCCCTGATTGCTCGAGGAAGGCAGCATTGGAGCAATTA
TCTTATTTGCTTCTCCTTGGCATGAGGAGTGTGCTGGTGCAGCTTGCGGTGCGCTAAATA
AAGTCACTGTGAAAATGGAGTGTGGGAGTCTGGTGTGTATTGTTGAGTATAAAATGAGGG
AGTCAATATGTAGTTAAGCAGGGATTACGGACAATGTGAGCCATCATTACTGAACAAGAT
GGTGTATGTGTGACGAACAATTAATTTAAACGATCGATATTGAAAATG

CDS

375 bp

>Os04t0623300-02 Similar to H0215F08.3 protein.
AATCCAGGTTCATATGGTGAAAATGTTAGGAGAAAGTCCCACACACCTTCTGCTATTGTT
ATCGGCAGTGGGTTTGCAGGCATTGCTGCAGCCAACGCTCTCAGGAATGCATCATTTGAG
GTTGTTCTTCTAGAATCTCGTGACAGGATAGGTGGTAGAATTCACACTGATTACTCTTTT
GGCTTTCCTGTTGATCTGGGAGCATCCTGGCTTCATGGTGTTTGTGAGGAAAATCCCCTG
GCACCAATTATTGGAAGGCTTGGACTTCCACTGTATCGCACAAGTGGAGATGACTCTGTG
CTGTTTGATCATGACCTTGAGAGGTTACTAGAGCTAGTTTATTTTGTATGTAACTTGAGA
GATGATGGACCATAA

Protein

125 aa

>Os04t0623300-02 Similar to H0215F08.3 protein.
NPGSYGENVRRKSHTPSAIVIGSGFAGIAAANALRNASFEVVLLESRDRIGGRIHTDYSF
GFPVDLGASWLHGVCEENPLAPIIGRLGLPLYRTSGDDSVLFDHDLERLLELVYFVCNLR
DDGP*

5'UTR

chr04:31671822..31673471 (- strand) : 1650 bp

CDS

chr04:31671702..31671821 (- strand) : 120 bp

chr04:31671492..31671580 (- strand) : 89 bp

chr04:31671222..31671387 (- strand) : 166 bp

3'UTR

chr04:31671102..31671221 (- strand) : 120 bp

chr04:31670929..31671014 (- strand) : 86 bp

chr04:31670741..31670843 (- strand) : 103 bp

chr04:31670534..31670631 (- strand) : 98 bp

chr04:31670002..31670431 (- strand) : 430 bp

chr04:31669247..31669912 (- strand) : 666 bp

FASTA

>Os04t0623300-02 class=Sequence position=chr04:31669247..31673471 (- strand)
GTGCACTTAA TGCAACCTTA GTGCAAAAAC CGAAATTTTC CACTCTCTAG GTGGTTGTAG TGATAAAATT GCTTTGATAA
TCTAAACACA CTGAGTTGCT TATGGTTGTT GGGAGGTGCC TAGTGGGCCA GATGAAAGAG ACATCAGCCA TCGTGGATGA
GTTCCCATAT TCCTCTGTCG GTGGTAGGAA GAGAAAACAA AACATTAGCT GTTTACACCT GTTGTACCAG CGCCTCAACC
AATTGGAACC TTCTAGGGTT TTTCTCATGG CGAGAGAAAG TCCTCCATGT GGAGTTGTAG GCTCCTGCTG CGCCTTTTAG
TTCCTGAAGA GCTTGCAATT TGTAAGACTC TAGTGTAAAC CGTTCATGCA AGCACTCACA TACTGGTTGC AGTTGAGGTC
TAACAACATG CAGATGCAGT AGTGCTTGAA CTTTAAATAT CATATACTTA CTATTCTAAA ATTAGATCAG CAAAAGTGCA
TGTCATGTTA AGTTTAGTGC CATGCGGACA TTCTATGCAT GCATGATTCA TATAGTATTG TAATGCATGT AGGGTGCAGA
TTATTATATG AGAATATTCG CTGGTGGATC TAGTTATCTA AGTTTCTTTA TCTTCCAATG CCACCATTTT CTTATTTTAC
TGTTCAGCTC TTATAAAATG TTTTTTCTGT TGGCTTTCGT TGCTGTCTCA TTTATGGATA TCTTTACTTT TGGATTGTGC
CTTTTAGTGC GCCTATAGTC ATTGTGTGAG ATGTTCGGTG GCCATTATTT TTTGCTTGTT AAGTGCTCTG AAGCATATCC
GGCAGAGGGT TGTCTCGCTA AAAGATTGTC TAATTTATAG TATGCCACCA AATAATTCCA AGATAAACAG TATATAGCCA
CAAATTCATG TCATGTCTAT CGCCCATTAG TCTGAATTTG CACCATGTCC ACATAACTAG AAAGAACAGT ACAATAATAA
TATTGTGTCC TTGCCTTTTG CACATCCTTT GAGGTCATTG TGTTTTAACG GAGAGTCTTT GGTGTGCCTG CCCAGCGAAA
AATTTGATCA GTCCTACATC TCAGCTTCCA ATGTGTAGCT ACAGACCAAG CGGttaggtt tctgtgggga atcaacagaa
tgttaaaatt gtcctgtctt acctcaccat cattgttctg agacagggga acatgcctca ctactaaccc tccatgatgg
agggggtaga ggagggttga tgtgagaaga acaggcgata tcggcaattt catcacttgg taggcttctt tatgttaatt
ctgtataaac tgatttttat catttggagg taTAAAACCC CCTTTCACAA TGAAGCAAAC CGTTAGCCTT AAGGTGCAAA
ACCTTTAGAT TCATGAAACA CAAGCATCCA TCCAACTACA TCAAACATGT GAAACTTTCA GGTTGCTTCC TGTGTTGACA
GTCATATAAA GAACATATGA TGGTACATGT GCCAGCCAGT ATTTGCACTT TAGATTTAAG CTGAATGAGC TCCTTTTTCA
ATGCAATATT TTGGCAAGAT AATAACCAAA AATTGACACA TCATTATTAT TTTATAATGT TTTAACTTTT TATTACTACA
CTTTGTCACT CTCATTGAGG TTCCTTTTTT TTTTCCTTTT TTTTTTGTAA AATCCAGGTT CATATGGTGA AAATGTTAGG
AGAAAGTCCC ACACACCTTC TGCTATTGTT ATCGGCAGTG GGTTTGCAGG CATTGCTGCA GCCAACGCTC TCAGGAATGC
ATCATTTGAG GTAATATGTG ATGCAGTTTA TGGCCTAATT GTAATGATAT AGGTTCAATG ATCCCTTGAA GTGCATTTCA
AATGTTGTGA AATTCTTCCC CACTGGTTAT TCTAATGTGG TTTCTTTCCA GGTTGTTCTT CTAGAATCTC GTGACAGGAT
AGGTGGTAGA ATTCACACTG ATTACTCTTT TGGCTTTCCT GTTGATCTGG GAGCATCCTG GTGAGGTTCC TCTCTGACAA
TATTTTCTGA ATTATTTGAA ATGGTGGCAA AAGTTTATCT GGAACCATTA TTTTTAATCC ACTTCCATTT TGTGTGAGCA
TCAGGCTTCA TGGTGTTTGT GAGGAAAATC CCCTGGCACC AATTATTGGA AGGCTTGGAC TTCCACTGTA TCGCACAAGT
GGAGATGACT CTGTGCTGTT TGATCATGAC CTTGAGAGGT TACTAGAGCT AGTTTATTTT GTATGTAACT TGAGAGATGA
TGGACCATAA TAATCAACCA TTTAACATGT TTTTTCCCTC AGTTATGCTC TCTATGACAC TAAGGGCCAT CAAGTTCCCC
AAGAGCTGGT AGAAAAGATA GGGAAGGTTT TTGAGACTAT ATTGGAAGAG GTATTACCTT GTTTCAGTTT CCATGCTTAT
TGTTGTTGCA TGATAATATT TTTGGTACTT GTTTTTCCCT AACATTTATA TGTGCAGACT GGCAAACTGA GGGAAGAAAC
TAAGGAAGAC ATTTCTATTG CGAAGGCCAT TGCAATTGTT ATGGAGAGAA ATCCACACTT GAGGTTTGTA CCATCCAATT
TCTGCCCATG TGCATAGGTT ATCCTGATCT TTTGGTCATT TTGCCTGACC TGTCCTTGTT CACAACAGGC AAGAAGGGAT
TGCTCATGAT GTTCTTCAGT GGTATTTGTG CCGCATGGAA GGTTGGTTTG CTACTGATGC GGACGCAATC TCTCTTCAGG
GTTGGGACCA GGTAGGACTT TGGTTCCTGA TATCAGCTAC AATTGCCAAT ATTTTGCTCA TGATGTACTC ATGCTAGTTT
GATTGCTATG TCTCATGTTC GTACTGTGCT GTGGGTGCAG GAGGTACTGC TTCCTGGTGG CCATGGTCTC ATGGTTCGTG
GATATCGTCC AGTAATAAAT ACTCTGGCAA AAGGCCTAGA TATACGCCTT GGCCACAGGT ATGCATATCC ATTTAGTTTT
TCCTTCTCAC TTTAAAAGCA AAATTCATGG TTCCATCCAC CATTCCTTAT TGCTAATCCA CATTATTTTC TTTTCTTTAG
GGTTGTTGAG ATTGTTCGCC ACAGGAATAG GGTGGAGGTT ACTGTAAGCA GTGGTAAAAC ATTTGTTGCG GATGCTGCAG
TCATTGCTGT CCCCTTAGGT GTTCTTAAAG CAAACACCAT TAAATTTGAA CCTAGGCTGC CAGAGTGGAA GGAGGAAGCA
ATAAGAGAAC TCTCAGTTGG AGTCGAGAAC AAAATAATTC TCCACTTCAG CGAGGTTTTC TGGCCTAATG TGGAGTTCCT
TGGAGTAGTT TCATCCACCA CATATGGCTG CAGCTATTTC CTCAACCTCC ACAAGGCTAC TGGCCATCCT GTTCTAGTTT
ACATGCCTGC GGGTCGGCTT GCATGTGACA TTGAAAAGCT GTCAGATGAG GCTGCTGCCC AATTTGCCTT CTCTCAGCTG
AAGAAGATCC TGCCCAACGC TGCCGAGCCG GTTAGTATCT TGACAAAAAT ATCAAATTTG GCAATCAAGA ATCTCTTTAT
GCTAGTTCTT ACAACCATGC TGCCCAAATC TTATTGCAGA TACATTACCT AGTGTCACAT TGGGGCTCAG ACGAGAATAC
ACTTGGATCC TACACCTTCG ATGGGGTGGG CAAACCTCGT GACCTGTATG AGAAGCTGCG GATCCCAGTC GATAACCTAT
TCTTTGCTGG AGAAGCCACC AGTGTCCAGT ACACTGGCAC GGTGCATGGC GCCTTCTCCA CTGGTCTGAT GGCAGCTGAG
GAGTGCCGAA TGAGGGTTCT TGAGCGGTTC AGGGAGCTGG ACATGCTGGA GATGTGCCAC CCTGCAATGG GGGAGCAGAC
CGCCACTGTC TCAGTCCCAC TGCTCATCTC CCGGCTGTGA ACAGACCAGG AGCTGCACAA AAATTATAGT CTTCTAAGGC
CATTTGGCAC TTGGCACCCG GCGAGCGCAC TAAGCCATTC CCCTGATTGC TCGAGGAAGG CAGCATTGGA GCAATTATCT
TATTTGCTTC TCCTTGGCAT GAGGAGTGTG CTGGTGCAGC TTGCGGTGCG CTAAATAAAG TCACTGTGAA AATGGAGTGT
GGGAGTCTGG TGTGTATTGT TGAGTATAAA ATGAGGGAGT CAATATGTAG TTAAGCAGGG ATTACGGACA ATGTGAGCCA
TCATTACTGA ACAAGATGGT GTATGTGTGA CGAACAATTA ATTTAAACGA TCGATATTGA AAATG

Locus: Os04g0623300

Loading...

Locus: Os04g0623300

Loading...