Os04t0623300-03

Locus

Os04g0623300

Description

Similar to H0215F08.3 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PAO3

CGSNL Gene Name

POLYAMINE OXIDASE 3

Oryzabase Gene Symbol Synonym(s)

OsPAO3, OsAO3, AO3

Oryzabase Gene Name Synonym(s)

Polyamine oxidase 3, Amine oxidase 3

Transcript Evidence

AK067242 (DDBJ, Best hit)

Protein Evidence

Q01KC7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Amine oxidase (IPR002937)

Full-length cDNA

J013095J23 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0623300-03)

RiceXPro (AK067242)

Others

Oryzabase (11404)

KEGG (Os04t0623300-03)

Transcript

1564 bp

>Os04t0623300-03 Similar to H0215F08.3 protein.
GCTTGGACTTCCACTGTATCGCACAAGTGGAGATGACTCTGTGCTGTTTGATCATGACCT
TGAGAGTTATGCTCTCTATGACACTAAGGGCCATCAAGTTCCCCAAGAGCTGGTAGAAAA
GATAGGGAAGGTTTTTGAGACTATATTGGAAGAGACTGGCAAACTGAGGGAAGAAACTAA
GGAAGACATTTCTATTGCGAAGGCCATTGCAATTGTTATGGAGAGAAATCCACACTTGAG
GCAAGAAGGGATTGCTCATGATGTTCTTCAGTGGTATTTGTGCCGCATGGAAGGTTGGTT
TGCTACTGATGCGGACGCAATCTCTCTTCAGGGTTGGGACCAGGAGGTACTGCTTCCTGG
TGGCCATGGTCTCATGGTTCGTGGATATCGTCCAGTAATAAATACTCTGGCAAAAGGCCT
AGATATACGCCTTGGCCACAGGGTTGTTGAGATTGTTCGCCACAGGAATAGGGTGGAGGT
TACTGTAAGCAGTGGTAAAACATTTGTTGCGGATGCTGCAGTCATTGCTGTCCCCTTAGG
TGTTCTTAAAGCAAACACCATTAAATTTGAACCTAGGCTGCCAGAGTGGAAGGAGGAAGC
AATAAGAGAACTCTCAGTTGGAGTCGAGAACAAAATAATTCTCCACTTCAGCGAGGTTTT
CTGGCCTAATGTGGAGTTCCTTGGAGTAGTTTCATCCACCACATATGGCTGCAGCTATTT
CCTCAACCTCCACAAGGCTACTGGCCATCCTGTTCTAGTTTACATGCCTGCGGGTCGGCT
TGCATGTGACATTGAAAAGCTGTCAGATGAGGCTGCTGCCCAATTTGCCTTCTCTCAGCT
GAAGAAGATCCTGCCCAACGCTGCCGAGCCGATACATTACCTAGTGTCACATTGGGGCTC
AGACGAGAATACACTTGGATCCTACACCTTCGATGGGGTGGGCAAACCTCGTGACCTGTA
TGAGAAGCTGCGGATCCCAGTCGATAACCTATTCTTTGCTGGAGAAGCCACCAGTGTCCA
GTACACTGGCACGGTGCATGGCGCCTTCTCCACTGGTCTGATGGCAGCTGAGGAGTGCCG
AATGAGGGTTCTTGAGCGGTTCAGGGAGCTGGACATGCTGGAGATGTGCCACCCTGCAAT
GGGGGAGCAGACCGCCACTGTCTCAGTCCCACTGCTCATCTCCCGGCTGTGAACAGACCA
GGAGCTGCACAAAAATTATAGTCTTCTAAGGCCATTTGGCACTTGGCACCCGGCGAGCGC
ACTAAGCCATTCCCCTGATTGCTCGAGGAAGGCAGCATTGGAGCAATTATCTTATTTGCT
TCTCCTTGGCATGAGGAGTGTGCTGGTGCAGCTTGCGGTGCGCTAAATAAAGTCACTGTG
AAAATGGAGTGTGGGAGTCTGGTGTGTATTGTTGAGTATAAAATGAGGGAGTCAATATGT
AGTTAAGCAGGGATTACGGACAATGTGAGCCATCATTACTGAACAAGATGGTGTATGTGT
GACGAACAATTAATTTAAACGATCGATATTGAAAATGAATGAGTGCTTTGCCCCCAAGTT
TGAC

CDS

1191 bp

>Os04t0623300-03 Similar to H0215F08.3 protein.
CTTGGACTTCCACTGTATCGCACAAGTGGAGATGACTCTGTGCTGTTTGATCATGACCTT
GAGAGTTATGCTCTCTATGACACTAAGGGCCATCAAGTTCCCCAAGAGCTGGTAGAAAAG
ATAGGGAAGGTTTTTGAGACTATATTGGAAGAGACTGGCAAACTGAGGGAAGAAACTAAG
GAAGACATTTCTATTGCGAAGGCCATTGCAATTGTTATGGAGAGAAATCCACACTTGAGG
CAAGAAGGGATTGCTCATGATGTTCTTCAGTGGTATTTGTGCCGCATGGAAGGTTGGTTT
GCTACTGATGCGGACGCAATCTCTCTTCAGGGTTGGGACCAGGAGGTACTGCTTCCTGGT
GGCCATGGTCTCATGGTTCGTGGATATCGTCCAGTAATAAATACTCTGGCAAAAGGCCTA
GATATACGCCTTGGCCACAGGGTTGTTGAGATTGTTCGCCACAGGAATAGGGTGGAGGTT
ACTGTAAGCAGTGGTAAAACATTTGTTGCGGATGCTGCAGTCATTGCTGTCCCCTTAGGT
GTTCTTAAAGCAAACACCATTAAATTTGAACCTAGGCTGCCAGAGTGGAAGGAGGAAGCA
ATAAGAGAACTCTCAGTTGGAGTCGAGAACAAAATAATTCTCCACTTCAGCGAGGTTTTC
TGGCCTAATGTGGAGTTCCTTGGAGTAGTTTCATCCACCACATATGGCTGCAGCTATTTC
CTCAACCTCCACAAGGCTACTGGCCATCCTGTTCTAGTTTACATGCCTGCGGGTCGGCTT
GCATGTGACATTGAAAAGCTGTCAGATGAGGCTGCTGCCCAATTTGCCTTCTCTCAGCTG
AAGAAGATCCTGCCCAACGCTGCCGAGCCGATACATTACCTAGTGTCACATTGGGGCTCA
GACGAGAATACACTTGGATCCTACACCTTCGATGGGGTGGGCAAACCTCGTGACCTGTAT
GAGAAGCTGCGGATCCCAGTCGATAACCTATTCTTTGCTGGAGAAGCCACCAGTGTCCAG
TACACTGGCACGGTGCATGGCGCCTTCTCCACTGGTCTGATGGCAGCTGAGGAGTGCCGA
ATGAGGGTTCTTGAGCGGTTCAGGGAGCTGGACATGCTGGAGATGTGCCACCCTGCAATG
GGGGAGCAGACCGCCACTGTCTCAGTCCCACTGCTCATCTCCCGGCTGTGA

Protein

397 aa

>Os04t0623300-03 Similar to H0215F08.3 protein.
LGLPLYRTSGDDSVLFDHDLESYALYDTKGHQVPQELVEKIGKVFETILEETGKLREETK
EDISIAKAIAIVMERNPHLRQEGIAHDVLQWYLCRMEGWFATDADAISLQGWDQEVLLPG
GHGLMVRGYRPVINTLAKGLDIRLGHRVVEIVRHRNRVEVTVSSGKTFVADAAVIAVPLG
VLKANTIKFEPRLPEWKEEAIRELSVGVENKIILHFSEVFWPNVEFLGVVSSTTYGCSYF
LNLHKATGHPVLVYMPAGRLACDIEKLSDEAAAQFAFSQLKKILPNAAEPIHYLVSHWGS
DENTLGSYTFDGVGKPRDLYEKLRIPVDNLFFAGEATSVQYTGTVHGAFSTGLMAAEECR
MRVLERFRELDMLEMCHPAMGEQTATVSVPLLISRL*

5'UTR

chr04:31671339..31671339 (- strand) : 1 bp

CDS

chr04:31671274..31671338 (- strand) : 65 bp

chr04:31671102..31671189 (- strand) : 88 bp

chr04:31670929..31671014 (- strand) : 86 bp

chr04:31670741..31670843 (- strand) : 103 bp

chr04:31670534..31670631 (- strand) : 98 bp

chr04:31670002..31670431 (- strand) : 430 bp

chr04:31669592..31669912 (- strand) : 321 bp

3'UTR

chr04:31669220..31669591 (- strand) : 372 bp

FASTA

>Os04t0623300-03 class=Sequence position=chr04:31669220..31671339 (- strand)
GCTTGGACTT CCACTGTATC GCACAAGTGG AGATGACTCT GTGCTGTTTG ATCATGACCT TGAGAGGTTA CTAGAGCTAG
TTTATTTTGT ATGTAACTTG AGAGATGATG GACCATAATA ATCAACCATT TAACATGTTT TTTCCCTCAG TTATGCTCTC
TATGACACTA AGGGCCATCA AGTTCCCCAA GAGCTGGTAG AAAAGATAGG GAAGGTTTTT GAGACTATAT TGGAAGAGGT
ATTACCTTGT TTCAGTTTCC ATGCTTATTG TTGTTGCATG ATAATATTTT TGGTACTTGT TTTTCCCTAA CATTTATATG
TGCAGACTGG CAAACTGAGG GAAGAAACTA AGGAAGACAT TTCTATTGCG AAGGCCATTG CAATTGTTAT GGAGAGAAAT
CCACACTTGA GGTTTGTACC ATCCAATTTC TGCCCATGTG CATAGGTTAT CCTGATCTTT TGGTCATTTT GCCTGACCTG
TCCTTGTTCA CAACAGGCAA GAAGGGATTG CTCATGATGT TCTTCAGTGG TATTTGTGCC GCATGGAAGG TTGGTTTGCT
ACTGATGCGG ACGCAATCTC TCTTCAGGGT TGGGACCAGG TAGGACTTTG GTTCCTGATA TCAGCTACAA TTGCCAATAT
TTTGCTCATG ATGTACTCAT GCTAGTTTGA TTGCTATGTC TCATGTTCGT ACTGTGCTGT GGGTGCAGGA GGTACTGCTT
CCTGGTGGCC ATGGTCTCAT GGTTCGTGGA TATCGTCCAG TAATAAATAC TCTGGCAAAA GGCCTAGATA TACGCCTTGG
CCACAGGTAT GCATATCCAT TTAGTTTTTC CTTCTCACTT TAAAAGCAAA ATTCATGGTT CCATCCACCA TTCCTTATTG
CTAATCCACA TTATTTTCTT TTCTTTAGGG TTGTTGAGAT TGTTCGCCAC AGGAATAGGG TGGAGGTTAC TGTAAGCAGT
GGTAAAACAT TTGTTGCGGA TGCTGCAGTC ATTGCTGTCC CCTTAGGTGT TCTTAAAGCA AACACCATTA AATTTGAACC
TAGGCTGCCA GAGTGGAAGG AGGAAGCAAT AAGAGAACTC TCAGTTGGAG TCGAGAACAA AATAATTCTC CACTTCAGCG
AGGTTTTCTG GCCTAATGTG GAGTTCCTTG GAGTAGTTTC ATCCACCACA TATGGCTGCA GCTATTTCCT CAACCTCCAC
AAGGCTACTG GCCATCCTGT TCTAGTTTAC ATGCCTGCGG GTCGGCTTGC ATGTGACATT GAAAAGCTGT CAGATGAGGC
TGCTGCCCAA TTTGCCTTCT CTCAGCTGAA GAAGATCCTG CCCAACGCTG CCGAGCCGGT TAGTATCTTG ACAAAAATAT
CAAATTTGGC AATCAAGAAT CTCTTTATGC TAGTTCTTAC AACCATGCTG CCCAAATCTT ATTGCAGATA CATTACCTAG
TGTCACATTG GGGCTCAGAC GAGAATACAC TTGGATCCTA CACCTTCGAT GGGGTGGGCA AACCTCGTGA CCTGTATGAG
AAGCTGCGGA TCCCAGTCGA TAACCTATTC TTTGCTGGAG AAGCCACCAG TGTCCAGTAC ACTGGCACGG TGCATGGCGC
CTTCTCCACT GGTCTGATGG CAGCTGAGGA GTGCCGAATG AGGGTTCTTG AGCGGTTCAG GGAGCTGGAC ATGCTGGAGA
TGTGCCACCC TGCAATGGGG GAGCAGACCG CCACTGTCTC AGTCCCACTG CTCATCTCCC GGCTGTGAAC AGACCAGGAG
CTGCACAAAA ATTATAGTCT TCTAAGGCCA TTTGGCACTT GGCACCCGGC GAGCGCACTA AGCCATTCCC CTGATTGCTC
GAGGAAGGCA GCATTGGAGC AATTATCTTA TTTGCTTCTC CTTGGCATGA GGAGTGTGCT GGTGCAGCTT GCGGTGCGCT
AAATAAAGTC ACTGTGAAAA TGGAGTGTGG GAGTCTGGTG TGTATTGTTG AGTATAAAAT GAGGGAGTCA ATATGTAGTT
AAGCAGGGAT TACGGACAAT GTGAGCCATC ATTACTGAAC AAGATGGTGT ATGTGTGACG AACAATTAAT TTAAACGATC
GATATTGAAA ATGAATGAGT GCTTTGCCCC CAAGTTTGAC 

Locus: Os04g0623300

Loading...

Locus: Os04g0623300

Loading...