Os04t0623300-04

Locus

Os04g0623300

Description

Similar to H0215F08.3 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PAO3

CGSNL Gene Name

POLYAMINE OXIDASE 3

Oryzabase Gene Symbol Synonym(s)

OsPAO3, OsAO3, AO3

Oryzabase Gene Name Synonym(s)

Polyamine oxidase 3, Amine oxidase 3

Transcript Evidence

AK061831 (DDBJ, Best hit)

Protein Evidence

Q01KC7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Amine oxidase (IPR002937)

Full-length cDNA

001-040-D02 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0623300-04)

RiceXPro (AK061831)

Others

Oryzabase (11404)

KEGG (Os04t0623300-04 (EC:1.-.-.-))

Transcript

1142 bp

>Os04t0623300-04 Similar to H0215F08.3 protein.
TAATAAATACTCTGGCAAAAGGCCTAGATATACGCCTTGGCCACAGGGTTGTTGAGATTG
TTCGCCACAGGAATAGGGTGGAGGTTACTGTAAGCAGTGGTAAAACATTTGTTGCGGATG
CTGCAGTCATTGCTGTCCCCTTAGGTGTTCTTAAAGCAAACACCATTAAATTTGAACCTA
GGCTGCCAGAGTGGAAGGAGGAAGCAATAAGAGAACTCTCAGTTGGAGTCGAGAACAAAA
TAATTCTCCACTTCAGCGAGGTTTTCTGGCCTAATGTGGAGTTCCTTGGAGTAGTTTCAT
CCACCACATATGGCTGCAGCTATTTCCTCAACCTCCACAAGGCTACTGGCCATCCTGTTC
TAGTTTACATGCCTGCGGGTCGGCTTGCATGTGACATTGAAAAGCTGTCAGATGAGGCTG
CTGCCCAATTTGCCTTCTCTCAGCTGAAGAAGATCCTGCCCAACGCTGCCGAGCCGATAC
ATTACCTAGTGTCACATTGGGGCTCAGACGAGAATACACTTGGATCCTACACCTTCGATG
GGGTGGGCAAACCTCGTGACCTGTATGAGAAGCTGCGGATCCCAGTCGATAACCTATTCT
TTGCTGGAGAAGCCACCAGTGTCCAGTACACTGGCACGGTGCATGGCGCCTTCTCCACTG
GTCTGATGGCAGCTGAGGAGTGCCGAATGAGGGTTCTTGAGCGGTTCAGGGAGCTGGACA
TGCTGGAGATGTGCCACCCTGCAATGGGGGAGCAGACCGCCACTGTCTCAGTCCCACTGC
TCATCTCCCGGCTGTGAACAGACCAGGAGCTGCACAAAAATTATAGTCTTCTAAGGCCAT
TTGGCACTTGGCACCCGGCGAGCGCACTAAGCCATTCCCCTGATTGCTCGAGGAAGGCAG
CATTGGAGCAATTATCTTATTTGCTTCTCCTTGGCATGAGGAGTGTGCTGGTGCAGCTTG
CGGTGCGCTAAATAAAGTCACTGTGAAAATGGAGTGTGGGAGTCTGGTGTGTATTGTTGA
GTATAAAATGAGGGAGTCAATATGTAGTTAAGCAGGGATTACGGACAATGTGAGCCATCA
TTACTGAACAAGATGGTGTATGTGTGACGAACAATTAATTTAAACGATCGATATTGAAAA
TG

CDS

795 bp

>Os04t0623300-04 Similar to H0215F08.3 protein.
ATAAATACTCTGGCAAAAGGCCTAGATATACGCCTTGGCCACAGGGTTGTTGAGATTGTT
CGCCACAGGAATAGGGTGGAGGTTACTGTAAGCAGTGGTAAAACATTTGTTGCGGATGCT
GCAGTCATTGCTGTCCCCTTAGGTGTTCTTAAAGCAAACACCATTAAATTTGAACCTAGG
CTGCCAGAGTGGAAGGAGGAAGCAATAAGAGAACTCTCAGTTGGAGTCGAGAACAAAATA
ATTCTCCACTTCAGCGAGGTTTTCTGGCCTAATGTGGAGTTCCTTGGAGTAGTTTCATCC
ACCACATATGGCTGCAGCTATTTCCTCAACCTCCACAAGGCTACTGGCCATCCTGTTCTA
GTTTACATGCCTGCGGGTCGGCTTGCATGTGACATTGAAAAGCTGTCAGATGAGGCTGCT
GCCCAATTTGCCTTCTCTCAGCTGAAGAAGATCCTGCCCAACGCTGCCGAGCCGATACAT
TACCTAGTGTCACATTGGGGCTCAGACGAGAATACACTTGGATCCTACACCTTCGATGGG
GTGGGCAAACCTCGTGACCTGTATGAGAAGCTGCGGATCCCAGTCGATAACCTATTCTTT
GCTGGAGAAGCCACCAGTGTCCAGTACACTGGCACGGTGCATGGCGCCTTCTCCACTGGT
CTGATGGCAGCTGAGGAGTGCCGAATGAGGGTTCTTGAGCGGTTCAGGGAGCTGGACATG
CTGGAGATGTGCCACCCTGCAATGGGGGAGCAGACCGCCACTGTCTCAGTCCCACTGCTC
ATCTCCCGGCTGTGA

Protein

265 aa

>Os04t0623300-04 Similar to H0215F08.3 protein.
INTLAKGLDIRLGHRVVEIVRHRNRVEVTVSSGKTFVADAAVIAVPLGVLKANTIKFEPR
LPEWKEEAIRELSVGVENKIILHFSEVFWPNVEFLGVVSSTTYGCSYFLNLHKATGHPVL
VYMPAGRLACDIEKLSDEAAAQFAFSQLKKILPNAAEPIHYLVSHWGSDENTLGSYTFDG
VGKPRDLYEKLRIPVDNLFFAGEATSVQYTGTVHGAFSTGLMAAEECRMRVLERFRELDM
LEMCHPAMGEQTATVSVPLLISRL*

5'UTR

chr04:31670578..31670579 (- strand) : 2 bp

CDS

chr04:31670534..31670577 (- strand) : 44 bp

chr04:31670002..31670431 (- strand) : 430 bp

chr04:31669592..31669912 (- strand) : 321 bp

3'UTR

chr04:31669247..31669591 (- strand) : 345 bp

FASTA

>Os04t0623300-04 class=Sequence position=chr04:31669247..31670579 (- strand)
TAATAAATAC TCTGGCAAAA GGCCTAGATA TACGCCTTGG CCACAGGTAT GCATATCCAT TTAGTTTTTC CTTCTCACTT
TAAAAGCAAA ATTCATGGTT CCATCCACCA TTCCTTATTG CTAATCCACA TTATTTTCTT TTCTTTAGGG TTGTTGAGAT
TGTTCGCCAC AGGAATAGGG TGGAGGTTAC TGTAAGCAGT GGTAAAACAT TTGTTGCGGA TGCTGCAGTC ATTGCTGTCC
CCTTAGGTGT TCTTAAAGCA AACACCATTA AATTTGAACC TAGGCTGCCA GAGTGGAAGG AGGAAGCAAT AAGAGAACTC
TCAGTTGGAG TCGAGAACAA AATAATTCTC CACTTCAGCG AGGTTTTCTG GCCTAATGTG GAGTTCCTTG GAGTAGTTTC
ATCCACCACA TATGGCTGCA GCTATTTCCT CAACCTCCAC AAGGCTACTG GCCATCCTGT TCTAGTTTAC ATGCCTGCGG
GTCGGCTTGC ATGTGACATT GAAAAGCTGT CAGATGAGGC TGCTGCCCAA TTTGCCTTCT CTCAGCTGAA GAAGATCCTG
CCCAACGCTG CCGAGCCGGT TAGTATCTTG ACAAAAATAT CAAATTTGGC AATCAAGAAT CTCTTTATGC TAGTTCTTAC
AACCATGCTG CCCAAATCTT ATTGCAGATA CATTACCTAG TGTCACATTG GGGCTCAGAC GAGAATACAC TTGGATCCTA
CACCTTCGAT GGGGTGGGCA AACCTCGTGA CCTGTATGAG AAGCTGCGGA TCCCAGTCGA TAACCTATTC TTTGCTGGAG
AAGCCACCAG TGTCCAGTAC ACTGGCACGG TGCATGGCGC CTTCTCCACT GGTCTGATGG CAGCTGAGGA GTGCCGAATG
AGGGTTCTTG AGCGGTTCAG GGAGCTGGAC ATGCTGGAGA TGTGCCACCC TGCAATGGGG GAGCAGACCG CCACTGTCTC
AGTCCCACTG CTCATCTCCC GGCTGTGAAC AGACCAGGAG CTGCACAAAA ATTATAGTCT TCTAAGGCCA TTTGGCACTT
GGCACCCGGC GAGCGCACTA AGCCATTCCC CTGATTGCTC GAGGAAGGCA GCATTGGAGC AATTATCTTA TTTGCTTCTC
CTTGGCATGA GGAGTGTGCT GGTGCAGCTT GCGGTGCGCT AAATAAAGTC ACTGTGAAAA TGGAGTGTGG GAGTCTGGTG
TGTATTGTTG AGTATAAAAT GAGGGAGTCA ATATGTAGTT AAGCAGGGAT TACGGACAAT GTGAGCCATC ATTACTGAAC
AAGATGGTGT ATGTGTGACG AACAATTAAT TTAAACGATC GATATTGAAA ATG

Locus: Os04g0623300

Loading...

Locus: Os04g0623300

Loading...