Os04t0624000-01

Locus

Os04g0624000

Description

Similar to Symbiosis-related like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ATG8B

CGSNL Gene Name

AUTOPHAGY ASSOCIATED GENE 8B

Oryzabase Gene Symbol Synonym(s)

OsATG8b, Atg8b

Oryzabase Gene Name Synonym(s)

autophagy 8b, OsAuTophaGy8b, AUTOPHAGY RELATED8b

Transcript Evidence

AK121268 (DDBJ, Best hit)

Protein Evidence

Q01KB9 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Autophagy protein Atg8 ubiquitin-like (IPR004241)

Full-length cDNA

J023105G11 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0624000-01)

RiceXPro (AK121268)

Others

Oryzabase (9645)

KEGG (Os04t0624000-01)

Transcript

774 bp

>Os04t0624000-01 Similar to Symbiosis-related like protein.
CCCACCACCCGTCTCCGCAACCCACACATCTCCATTGCGCCAAGGAAGAAGAAACCCTCC
CCCTCCCTCTCCCCAATCCAATCCAATCCAATCCGGCGAGTCGCGTGAGTTTCCGCTCCC
CTCTTCCGTCGATTCGGCATCGGGTTCGCCGATCAGGGGGGCTTCCTTGTCCGATTTGGT
GGTTGATTCGTGTTTTTGCTCGTGTTCTCCAGGACCAGCTCAGTCTCTCGAAGGAGCGCC
ATGGCCAAGAGCTCGTTCAAGCTGGACCACACGCTCGAGAGGAGGCAGGCTGAGGCTAAC
CGTATCAGAGAAAAGTACAGTGACAGAATTCCTGTGATTGTTGAGAAAGCTGAAAGAAGT
GATATTCCTGACATCGACAAGAAAAAGTACCTGGTCCCTGCTGATCTTACCGTTGGGCAG
TTTGTCTATGTTGTTCGGAAGCGGATCAAGCTCAGTCCTGAGAAAGCAATCTTCATCTTT
GTGAAGAATACTCTTCCACCAACAGCTGCTCTGATGTCCGCAATTTACGAGGAGAACAAG
GATGAGGATGGGTTCCTCTACATGACCTACAGTGGCGAGAACACCTTTGGGCTGCTCTAG
GCGCGGCAGCAATATCGCTCTCAACTCCTGTAAATAAGACTTGCCAAACAAGTGTATATT
CTTTGCTTACCTCGTGGCAAATCTTTAAACTCTAATAGTAGTAATGCCAAGATCCTCTCA
GTTGTTCTGAACATATATACGCTGCTTGATAATACTCCCAAGTAATTGTGGCTC

CDS

360 bp

>Os04t0624000-01 Similar to Symbiosis-related like protein.
ATGGCCAAGAGCTCGTTCAAGCTGGACCACACGCTCGAGAGGAGGCAGGCTGAGGCTAAC
CGTATCAGAGAAAAGTACAGTGACAGAATTCCTGTGATTGTTGAGAAAGCTGAAAGAAGT
GATATTCCTGACATCGACAAGAAAAAGTACCTGGTCCCTGCTGATCTTACCGTTGGGCAG
TTTGTCTATGTTGTTCGGAAGCGGATCAAGCTCAGTCCTGAGAAAGCAATCTTCATCTTT
GTGAAGAATACTCTTCCACCAACAGCTGCTCTGATGTCCGCAATTTACGAGGAGAACAAG
GATGAGGATGGGTTCCTCTACATGACCTACAGTGGCGAGAACACCTTTGGGCTGCTCTAG

Protein

120 aa

>Os04t0624000-01 Similar to Symbiosis-related like protein.
MAKSSFKLDHTLERRQAEANRIREKYSDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQ
FVYVVRKRIKLSPEKAIFIFVKNTLPPTAALMSAIYEENKDEDGFLYMTYSGENTFGLL*

5'UTR

chr04:31718924..31719152 (- strand) : 229 bp

chr04:31718807..31718817 (- strand) : 11 bp

CDS

chr04:31718770..31718806 (- strand) : 37 bp

chr04:31717647..31717702 (- strand) : 56 bp

chr04:31717505..31717557 (- strand) : 53 bp

chr04:31716813..31716931 (- strand) : 119 bp

chr04:31716573..31716667 (- strand) : 95 bp

3'UTR

chr04:31716399..31716572 (- strand) : 174 bp

FASTA

>Os04t0624000-01 class=Sequence position=chr04:31716399..31719152 (- strand)
CCCACCACCC GTCTCCGCAA CCCACACATC TCCATTGCGC CAAGGAAGAA GAAACCCTCC CCCTCCCTCT CCCCAATCCA
ATCCAATCCA ATCCGGCGAG TCGCGTGAGT TTCCGCTCCC CTCTTCCGTC GATTCGGCAT CGGGTTCGCC GATCAGGGGG
GCTTCCTTGT CCGATTTGGT GGTTGATTCG TGTTTTTGCT CGTGTTCTCC AGGACCAGCT CAGTCTCTCG TAAGGGTTTG
ATCGAGTTGT TGTGTTTCGT TGCGCGATTG GCTTCGATCG GTGTGTTTCT GGTGGTTAAT TTTTTGGGGG GCGCTGATTT
GGTGATTGTG TGCAGGAAGG AGCGCCATGG CCAAGAGCTC GTTCAAGCTG GACCACACGC TCGGTCGGTT TGTTTTCTTA
TCGTGTTCCT CTTTTTATTT TTTCCTATAT GTGCTTTAGT AGTGTGGCTG CGATGATTGC GTGTTGGGTT TATTTGTTCG
ATAATTGATT GAATGTGTGC GAAGACGAGA GAAAGAGACA CAGGAATATG TTTTTTCCCC CGGTTTAAGG GGATGGCTTA
CCAAAACATC TGAATGTGTG TGGTAGCAAC TGTTTATTGA ATTGTGCATG TTCTGTGCGA ATCTGGGAGT AGGAGTAGGT
TGCGATTGCT ACAAAGTTGT GTGACTGATT TGAATTTGGT AGTAATAATA GTAGTACATG CCTTTTCATA ATGGGAATAG
TAGGTTCTGT GCGGATGGAT AGAGGGATGG TTAATGGGGA AAATATGTCA TCATTACTGA TGAATCAAAT TATAAAGAGC
CTCAATGTGT CTATCTGAAT TTCTGATACA CCAGTTTTAA CTATTATGTA AGGCTGTAAA ACCCAATATC TCTAGTATTG
TAGACTATAA ATTAACAGTT GACCTGACAA TCCAGCATCA TTAGCTGATT CTTTGATTTG TTTTTAAGAC TTATGTGGTC
TTGTTCCTTT TCTGATGGAT CGTATAAGGA ATAGACTTTC CAATTCAATC ACCCAACACT TTATGCTTGA GAACATGGTT
TTGGTAGTCT ATTGCATGTT TAGGGGTTGC TGTAAATCCT GCCCAATCTT CTGTGAAAGG GCCCTGATGT TTAGTATCAT
GCTTTTTTTC ACTGAGTTAT TTCTTCCTGT CTAATTTTTT ATCTTTTACC TTTTGTGCTT GAACAATATT TAAGTTGATT
AATGTGTGTG CCAACATGAT AGCATAGATT CCTTTTTTGA GAAATAGACA GCATAAGTAT TGCACTTTTT TGGTTGCCCT
TTCTTGTAAT CACTCTGTTA TTATAGTTTT CTCTACAGTG ATTTGAAATC TCTGATTTCT CGTTCTCCAT CTTCTACAAC
CTTGATTTAT GTATACATTT TAGAGATGTT TCAGCCTTTT AGTCAGTTCA TAATAACCAA AATCTTGTTC TTCTTGTGCA
TGTATTTCAG AGAGGAGGCA GGCTGAGGCT AACCGTATCA GAGAAAAGTA CAGTGACAGA ATTCCTGTAA GCTTGCTCTT
CATATTGCTC AGTTATGTTG TTTCCTTCAT TGTGGTTTTT TTGCTCTAAT TTGTTACATA TCTAATGTAA TGTAGGTGAT
TGTTGAGAAA GCTGAAAGAA GTGATATTCC TGACATCGAC AAGAAAAAGT CAGTTTCCAA GCATTTACGA AACCATAGCA
TTTAGATTTT TATTTAGTTA GTCTATTGAA CCGCTAAAGG AAGGAATATT GTCTTTAATT GCTATCAAGT AAATGCTAGT
GGAGGACTTC AGGTGTTCAG ATGATAGCAA CTAGTAGCTC TTGCCATTCA TTTATCCTTA TCTAGGACTG CATTGATGCA
ATGGTATTGC TTGTGGGTCC TTTGGGGGCA TATTTCATTT TATTATAATT GTTTCAAGGA CTTAAAGTCA TGATTAACGG
TGTCCTATAA ACTTTTTTGG TACTAGCAGT ACAGCATCAT TACAGTACTT GCATCACATT AAATCCTTTA TGCTCTTTTT
AGTTAAACAT GTAGTAGTAT TTACTATTTA TCACTGTAAA GTCCTAACTC TATGTTCCAA AAGCAGCTGA CTGTGTTTCA
ATTTATTATT GCAAGGATGC CGGTATGGCT ATGGCATTCA AGCTCGAAAC TTTTGTTGCT CTGAAACTTT AATACATGTT
ACATCAAGTA TCAATCAATA TTACCGTATC ATCCTTAGTA GCTTATGATT TTCTAATATA GGTACCTGGT CCCTGCTGAT
CTTACCGTTG GGCAGTTTGT CTATGTTGTT CGGAAGCGGA TCAAGCTCAG TCCTGAGAAA GCAATCTTCA TCTTTGTGAA
GAATACTCTT CCACCAACAG GTCTGAAAAT CCCTTGAATC ATTTTCCTTT GAAAACACAA GGACTTTGGT CGAATAGTAT
ACTACTGCAT GGTTTATGAT CCCAGTATCT CAAAGAACCT GCATGGTTCA TGTTATCTCA TTTCATCACT TTGTTGGATT
TGCAGCTGCT CTGATGTCCG CAATTTACGA GGAGAACAAG GATGAGGATG GGTTCCTCTA CATGACCTAC AGTGGCGAGA
ACACCTTTGG GCTGCTCTAG GCGCGGCAGC AATATCGCTC TCAACTCCTG TAAATAAGAC TTGCCAAACA AGTGTATATT
CTTTGCTTAC CTCGTGGCAA ATCTTTAAAC TCTAATAGTA GTAATGCCAA GATCCTCTCA GTTGTTCTGA ACATATATAC
GCTGCTTGAT AATACTCCCA AGTAATTGTG GCTC