Os04t0627000-02

Locus

Os04g0627000

Description

Similar to Homeobox-leucine zipper protein ROC2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ROC2

CGSNL Gene Name

RICE OUTMOST CELL-SPECIFIC GENE 2

Oryzabase Gene Symbol Synonym(s)

Roc2(t), Roc2, GL2-2

Oryzabase Gene Name Synonym(s)

Rice outmost cell-specific gene 2(t), Rice outermost cell-specific gene-2, Homeobox-leucine zipper protein ROC2, Homeodomain transcription factor ROC2, HD-ZIP protein ROC2, Protein RICE OUTERMOST CELL-SPECIFIC 2, GLABRA 2-like homeobox protein 2

Transcript Evidence

AK101563 (DDBJ, Best hit)

Protein Evidence

Q0J9X2 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Lipid-binding START (IPR002913)

START-like domain (IPR023393)

Full-length cDNA

J033050E18 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0627000-02)

RiceXPro (AK101563)

Others

Oryzabase (2863)

KEGG (Os04t0627000-02)

Transcript

2262 bp

>Os04t0627000-02 Similar to Homeobox-leucine zipper protein ROC2.
GCGGCCCCGCCGCCCTCGGCGAGATGTCCTTCGACGAGCACCACCTCCGCATCGAGAACG
CCCGCCTCCGCGAAGAGATCGATAGGATATCGGCGATCGCGGCGAAGTACGTGGGGAAGC
CAATGGTGCCGTTCCCGGTGCTGTCGAACCCGATGGCGGCGGCGGCGTCGCGGGCGCCGC
TGGACCTCCCCGTGGCGCCGTACGGCGTGCCGGGCGACATGTTCGGCGGCGGTGGCGCCG
GGGAGCTGCTGCGCGGGGTGCAGTCGGAGGTCGACAAGCCGATGATCGTGGAGCTCGCCG
TGGCGGCGATGGAGGAGCTGGTCCGCATGGCGCAGCTGGACGAGCCGCTCTGGAGCGTCG
CGCCGCCGCTCGACGCCACGGCGGCGGCGATGGAGACGCTCAGCGAGGAGGAGTACGCGC
GCATGTTCCCCCGAGGGCTCGGCCCCAAGCAGTACGGGCTCAGGTCGGAGGCGTCCCGCG
ACAGCGCCGTCGTCATCATGACGCACGCCAACCTCGTCGAGATCCTCATGGACGCGAATC
AGTACGCGGCAGTGTTCTCGAACATCGTGTCGAGGGCCATCACGCTGGAGGTGCTGTCCA
CCGGCGTCGCGGGGAACTACAACGGTGCATTGCAAGTGATGTCAGTGGAGTTTCAGGTGC
CATCGCCACTGGTGCCAACGAGAGAGAGCTACTTCGTGAGATACTGCAAGCAGAACGCAG
ACGGGACATGGGCCGTCGTCGACGTCTCGCTGGACAGCCTCCGCCCTAGCCCCGTCCTCA
AATGTCGCCGCCGTCCGTCAGGCTGCCTCATCCAAGAAATGCCCAATGGCTACTCCAAGG
TGACGTGGGTGGAGCATGTGGAGGTGGACGACAGGTCGGTGCACAACATCTACAAGCTGC
TGGTGAACTCCGGGCTGGCGTTCGGCGCGCGGCGGTGGGTCGGCACGCTGGACCGCCAGT
GCGAGCGCCTCGCCAGCGTCATGGCCAGCAACATCCCCACCAGCGACATCGGCGTGATTA
CGAGCTCGGAGGGGAGGAAGAGCATGCTGAAGCTGGCGGAGAGGATGGTGGTGAGCTTCT
GCGGCGGCGTGACGGCGTCGGTGGCGCATCAGTGGACGACGCTGTCCGGCAGCGGCGCCG
AGGACGTCCGCGTCATGACGAGGAAGAGCGTCGACGACCCCGGGAGGCCCCCCGGCATCG
TCCTCAACGCCGCCACCTCCTTCTGGCTCCCCGTCCCTCCCAAGCGCGTCTTCGACTTCC
TCCGCGACGAATCCTCTCGCAGTGAGTGGGACATCCTCTCCAATGGCGGTATCGTTCAAG
AAATGGCCCACATCGCCAATGGCCGGGATCAGGGCAACTGCGTCTCACTTCTTCGCGTCA
ACAGCTCGAACTCGAACCAGAGCAACATGCTGATCCTGCAGGAGAGCTGCACGGACGCGT
CGGGGTCGTACGTCATCTACGCGCCGGTGGACGTGGTTGCGATGAACGTCGTGCTAAACG
GCGGCGACCCGGACTACGTCGCGCTGCTGCCATCGGGCTTCGCCATCCTGCCCGATGGGC
CGGCGCACGACGGTGGCGACGGCGACGGCGGCGTCGGCGTCGGCTCCGGCGGGTCGCTGC
TGACGGTGGCGTTCCAGATACTGGTGGACTCCGTCCCGACGGCGAAGCTCTCGCTGGGGT
CGGTGGCGACGGTGAACAGCCTCATCGCCTGCACGGTGGAGCGCATCAAGGCGGCCGTCT
CCGGCGAGAGCAATCCGCAGTAGCTTCGTCCTTGAATCAAACAAAAGCTTCTTGTGCTTT
CAATTTCAGGAGCAGCAAAATTTTGGAGCTTTCATCAGTGGGAAGTCAAGAACGCACCTC
AGACTGTCCTTGCCATGTGGTGCCCATATATAGTTTGGATTATTTTTCGCTAGTTTTTCC
GCAAATTCGGGAAATTTCAAAAAAAATGTGTCACCACTACGCAAGGGCGGTTGGTTCGGG
TATTGACTTCCTCTTCATGTTCGCCTCTCGGATGCTGCTACCTTATGAATTTAGGGTTCT
TCTGGAGTACAAAAAAAACCCCTTAATTTGATCTGTAATTTCTGTTGTTCAGACTTCCCA
GTACCTAGCTAGCTAGTAGGAGTTGCAGAATAGAGATCTGTGTCCCTGTCTTATACTTTT
AGTTCTCTTCAGTGTTTGATCAGTGCTGTTTCAATCCAAAATTGTGTGTGCTGTGCTTGT
TATTAGTTCTTCCTTGCTGCTTCAATGAAGGCGATGTTAATT

CDS

1761 bp

>Os04t0627000-02 Similar to Homeobox-leucine zipper protein ROC2.
GGCCCCGCCGCCCTCGGCGAGATGTCCTTCGACGAGCACCACCTCCGCATCGAGAACGCC
CGCCTCCGCGAAGAGATCGATAGGATATCGGCGATCGCGGCGAAGTACGTGGGGAAGCCA
ATGGTGCCGTTCCCGGTGCTGTCGAACCCGATGGCGGCGGCGGCGTCGCGGGCGCCGCTG
GACCTCCCCGTGGCGCCGTACGGCGTGCCGGGCGACATGTTCGGCGGCGGTGGCGCCGGG
GAGCTGCTGCGCGGGGTGCAGTCGGAGGTCGACAAGCCGATGATCGTGGAGCTCGCCGTG
GCGGCGATGGAGGAGCTGGTCCGCATGGCGCAGCTGGACGAGCCGCTCTGGAGCGTCGCG
CCGCCGCTCGACGCCACGGCGGCGGCGATGGAGACGCTCAGCGAGGAGGAGTACGCGCGC
ATGTTCCCCCGAGGGCTCGGCCCCAAGCAGTACGGGCTCAGGTCGGAGGCGTCCCGCGAC
AGCGCCGTCGTCATCATGACGCACGCCAACCTCGTCGAGATCCTCATGGACGCGAATCAG
TACGCGGCAGTGTTCTCGAACATCGTGTCGAGGGCCATCACGCTGGAGGTGCTGTCCACC
GGCGTCGCGGGGAACTACAACGGTGCATTGCAAGTGATGTCAGTGGAGTTTCAGGTGCCA
TCGCCACTGGTGCCAACGAGAGAGAGCTACTTCGTGAGATACTGCAAGCAGAACGCAGAC
GGGACATGGGCCGTCGTCGACGTCTCGCTGGACAGCCTCCGCCCTAGCCCCGTCCTCAAA
TGTCGCCGCCGTCCGTCAGGCTGCCTCATCCAAGAAATGCCCAATGGCTACTCCAAGGTG
ACGTGGGTGGAGCATGTGGAGGTGGACGACAGGTCGGTGCACAACATCTACAAGCTGCTG
GTGAACTCCGGGCTGGCGTTCGGCGCGCGGCGGTGGGTCGGCACGCTGGACCGCCAGTGC
GAGCGCCTCGCCAGCGTCATGGCCAGCAACATCCCCACCAGCGACATCGGCGTGATTACG
AGCTCGGAGGGGAGGAAGAGCATGCTGAAGCTGGCGGAGAGGATGGTGGTGAGCTTCTGC
GGCGGCGTGACGGCGTCGGTGGCGCATCAGTGGACGACGCTGTCCGGCAGCGGCGCCGAG
GACGTCCGCGTCATGACGAGGAAGAGCGTCGACGACCCCGGGAGGCCCCCCGGCATCGTC
CTCAACGCCGCCACCTCCTTCTGGCTCCCCGTCCCTCCCAAGCGCGTCTTCGACTTCCTC
CGCGACGAATCCTCTCGCAGTGAGTGGGACATCCTCTCCAATGGCGGTATCGTTCAAGAA
ATGGCCCACATCGCCAATGGCCGGGATCAGGGCAACTGCGTCTCACTTCTTCGCGTCAAC
AGCTCGAACTCGAACCAGAGCAACATGCTGATCCTGCAGGAGAGCTGCACGGACGCGTCG
GGGTCGTACGTCATCTACGCGCCGGTGGACGTGGTTGCGATGAACGTCGTGCTAAACGGC
GGCGACCCGGACTACGTCGCGCTGCTGCCATCGGGCTTCGCCATCCTGCCCGATGGGCCG
GCGCACGACGGTGGCGACGGCGACGGCGGCGTCGGCGTCGGCTCCGGCGGGTCGCTGCTG
ACGGTGGCGTTCCAGATACTGGTGGACTCCGTCCCGACGGCGAAGCTCTCGCTGGGGTCG
GTGGCGACGGTGAACAGCCTCATCGCCTGCACGGTGGAGCGCATCAAGGCGGCCGTCTCC
GGCGAGAGCAATCCGCAGTAG

Protein

587 aa

>Os04t0627000-02 Similar to Homeobox-leucine zipper protein ROC2.
GPAALGEMSFDEHHLRIENARLREEIDRISAIAAKYVGKPMVPFPVLSNPMAAAASRAPL
DLPVAPYGVPGDMFGGGGAGELLRGVQSEVDKPMIVELAVAAMEELVRMAQLDEPLWSVA
PPLDATAAAMETLSEEEYARMFPRGLGPKQYGLRSEASRDSAVVIMTHANLVEILMDANQ
YAAVFSNIVSRAITLEVLSTGVAGNYNGALQVMSVEFQVPSPLVPTRESYFVRYCKQNAD
GTWAVVDVSLDSLRPSPVLKCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRSVHNIYKLL
VNSGLAFGARRWVGTLDRQCERLASVMASNIPTSDIGVITSSEGRKSMLKLAERMVVSFC
GGVTASVAHQWTTLSGSGAEDVRVMTRKSVDDPGRPPGIVLNAATSFWLPVPPKRVFDFL
RDESSRSEWDILSNGGIVQEMAHIANGRDQGNCVSLLRVNSSNSNQSNMLILQESCTDAS
GSYVIYAPVDVVAMNVVLNGGDPDYVALLPSGFAILPDGPAHDGGDGDGGVGVGSGGSLL
TVAFQILVDSVPTAKLSLGSVATVNSLIACTVERIKAAVSGESNPQ*

5'UTR

chr04:31903677..31903678 (- strand) : 2 bp

CDS

chr04:31903602..31903676 (- strand) : 75 bp

chr04:31903050..31903508 (- strand) : 459 bp

chr04:31902816..31902917 (- strand) : 102 bp

chr04:31902471..31902671 (- strand) : 201 bp

chr04:31902181..31902355 (- strand) : 175 bp

chr04:31901772..31902043 (- strand) : 272 bp

chr04:31901308..31901403 (- strand) : 96 bp

chr04:31900823..31901203 (- strand) : 381 bp

3'UTR

chr04:31900777..31900822 (- strand) : 46 bp

chr04:31900217..31900669 (- strand) : 453 bp

FASTA

>Os04t0627000-02 class=Sequence position=chr04:31900217..31903678 (- strand)
GCGGCCCCGC CGCCCTCGGC GAGATGTCCT TCGACGAGCA CCACCTCCGC ATCGAGAACG CCCGCCTCCG CGAAGAGGTA
GTTTTCACCA TATCTGAACA ATCGATCGAT CATGGTGACA CCGCCATTGC ATGGATCGTC GCACGCTGAT CGTGTCGTTG
TGCTTGTCAG ATCGATAGGA TATCGGCGAT CGCGGCGAAG TACGTGGGGA AGCCAATGGT GCCGTTCCCG GTGCTGTCGA
ACCCGATGGC GGCGGCGGCG TCGCGGGCGC CGCTGGACCT CCCCGTGGCG CCGTACGGCG TGCCGGGCGA CATGTTCGGC
GGCGGTGGCG CCGGGGAGCT GCTGCGCGGG GTGCAGTCGG AGGTCGACAA GCCGATGATC GTGGAGCTCG CCGTGGCGGC
GATGGAGGAG CTGGTCCGCA TGGCGCAGCT GGACGAGCCG CTCTGGAGCG TCGCGCCGCC GCTCGACGCC ACGGCGGCGG
CGATGGAGAC GCTCAGCGAG GAGGAGTACG CGCGCATGTT CCCCCGAGGG CTCGGCCCCA AGCAGTACGG GCTCAGGTCG
GAGGCGTCCC GCGACAGCGC CGTCGTCATC ATGACGCACG CCAACCTCGT CGAGATCCTC ATGGACGCGG TAAGCTCTTG
GTTAATTTTC TGTCAGTCAG TGCGCTATTC TTGTCTGAAT GTTTTTTAGT TTGGTGATTT TTATGATCCT GTTTGATTGT
TGGGGTCTGA ATTTCGTTCA AATTTTGAGT GAATTGCGCA GAATCAGTAC GCGGCAGTGT TCTCGAACAT CGTGTCGAGG
GCCATCACGC TGGAGGTGCT GTCCACCGGC GTCGCGGGGA ACTACAACGG TGCATTGCAA GTGGTATGTG TTCATGCTTG
TCTTAAAAAT TTTGTCTCCT TTCTGAATCT TCTGTCATAT TCGGTAGTAC CAAAGAATTC GAAGTGTGTA CATGTTGGTC
ACTGAAATGG GACAAAATTG TGTTGGTTTT GGCCGTTTTC TCTGCAGATG TCAGTGGAGT TTCAGGTGCC ATCGCCACTG
GTGCCAACGA GAGAGAGCTA CTTCGTGAGA TACTGCAAGC AGAACGCAGA CGGGACATGG GCCGTCGTCG ACGTCTCGCT
GGACAGCCTC CGCCCTAGCC CCGTCCTCAA ATGTCGCCGC CGTCCGTCAG GCTGCCTCAT CCAAGAAATG CCCAATGGCT
ACTCCAAGGT GACCATCATC AGCTCATCAT CATCATCATC ACAAATCAAA TCTGAAATTC TGAATTCAAG ATATATTGCT
GTTCAGAAAT CATGGAAAAC TGATGAAATT GTTGTATGAT CAGGTGACGT GGGTGGAGCA TGTGGAGGTG GACGACAGGT
CGGTGCACAA CATCTACAAG CTGCTGGTGA ACTCCGGGCT GGCGTTCGGC GCGCGGCGGT GGGTCGGCAC GCTGGACCGC
CAGTGCGAGC GCCTCGCCAG CGTCATGGCC AGCAACATCC CCACCAGCGA CATCGGCGGT AAGTAATTGA TCGAGCATGC
AGCGAATTTC ACCCTTTAAT TTGATCCAAA ACGAAATTAA AATTCAGATA TGTTCAATCA CTAAACCACG CAGTGGATTT
AATTGTGTTT GTTGAATGAA TGAATATAAT TGCAGTGATT ACGAGCTCGG AGGGGAGGAA GAGCATGCTG AAGCTGGCGG
AGAGGATGGT GGTGAGCTTC TGCGGCGGCG TGACGGCGTC GGTGGCGCAT CAGTGGACGA CGCTGTCCGG CAGCGGCGCC
GAGGACGTCC GCGTCATGAC GAGGAAGAGC GTCGACGACC CCGGGAGGCC CCCCGGCATC GTCCTCAACG CCGCCACCTC
CTTCTGGCTC CCCGTCCCTC CCAAGCGCGT CTTCGACTTC CTCCGCGACG AATCCTCTCG CAGTGAGGta ctccctctgt
tttatatcat aagtcgcttt tacgtcaaaa aaaaagtcgc tttgtttttt attcagatga attttgtaaa aaaaaacata
gtagcgcttt taatacaaag caaacacatt ttatcacaat atattcaata ttaaatttaa taaaactaat ttaatatttt
atatgctatt aattttttta aaattttatt taacttaata aagtttgact aggaaagaag tcaatacgac ttataatatt
aaacagaTAG AATACCTATA AATCCATGAT AAGGTTAACA AGAATACAAT TACAAACTCT TAGTTCGCGA AAAAAATTAC
AAAATCTTAA ACTTTGAAAA TAAATTTATT TTCAGTGGGA CATCCTCTCC AATGGCGGTA TCGTTCAAGA AATGGCCCAC
ATCGCCAATG GCCGGGATCA GGGCAACTGC GTCTCACTTC TTCGCGTCAA CGTAAGCAGC AATTCATCCA AGATCAAAAC
GCAAGATATA TACGAGCATG CGATAATGCG CGATGTATTG ATCGATCCCG TTTCATGTAC AAATATATAT TGCAGAGCTC
GAACTCGAAC CAGAGCAACA TGCTGATCCT GCAGGAGAGC TGCACGGACG CGTCGGGGTC GTACGTCATC TACGCGCCGG
TGGACGTGGT TGCGATGAAC GTCGTGCTAA ACGGCGGCGA CCCGGACTAC GTCGCGCTGC TGCCATCGGG CTTCGCCATC
CTGCCCGATG GGCCGGCGCA CGACGGTGGC GACGGCGACG GCGGCGTCGG CGTCGGCTCC GGCGGGTCGC TGCTGACGGT
GGCGTTCCAG ATACTGGTGG ACTCCGTCCC GACGGCGAAG CTCTCGCTGG GGTCGGTGGC GACGGTGAAC AGCCTCATCG
CCTGCACGGT GGAGCGCATC AAGGCGGCCG TCTCCGGCGA GAGCAATCCG CAGTAGCTTC GTCCTTGAAT CAAACAAAAG
CTTCTTGTGC TTTCAATTTC AGGTACAAAT GCACCAAATT ACTTCAGAAC TCTTGCGAGA TTAATTGCAT CAGTTAATGA
GAGGTATATC TGTAAAATTT CTGATGAGTT TGATCATGTT TGTGTGCAGG AGCAGCAAAA TTTTGGAGCT TTCATCAGTG
GGAAGTCAAG AACGCACCTC AGACTGTCCT TGCCATGTGG TGCCCATATA TAGTTTGGAT TATTTTTCGC TAGTTTTTCC
GCAAATTCGG GAAATTTCAA AAAAAATGTG TCACCACTAC GCAAGGGCGG TTGGTTCGGG TATTGACTTC CTCTTCATGT
TCGCCTCTCG GATGCTGCTA CCTTATGAAT TTAGGGTTCT TCTGGAGTAC AAAAAAAACC CCTTAATTTG ATCTGTAATT
TCTGTTGTTC AGACTTCCCA GTACCTAGCT AGCTAGTAGG AGTTGCAGAA TAGAGATCTG TGTCCCTGTC TTATACTTTT
AGTTCTCTTC AGTGTTTGAT CAGTGCTGTT TCAATCCAAA ATTGTGTGTG CTGTGCTTGT TATTAGTTCT TCCTTGCTGC
TTCAATGAAG GCGATGTTAA TT

Locus: Os04g0627000

Loading...

Locus: Os04g0627000

Loading...