Os04t0629100-01

Locus

Os04g0629100

Description

Similar to H0303G06.16 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET21, SDG722

Oryzabase Gene Name Synonym(s)

SET protein 21

Transcript Evidence

AK065665 (DDBJ, Best hit)

Protein Evidence

Q25A43 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

SET domain (IPR001214)

Zinc finger, MYND-type (IPR002893)

Full-length cDNA

J013041I04 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0629100-01)

Others

Oryzabase (13386)

Transcript

1856 bp

>Os04t0629100-01 Similar to H0303G06.16 protein.
ATAGCTCGAACACGTATGTTCATATCCACACCTCTCCCCCAAGTACGAGACAAGGTCTCG
AGAACAAAACCCCCCAAACCCCACGGCGGCGGCGGCGAGCGGCGGCGGAAGAAGCAGCCG
CAAGAGGCAGCAGCTCGCGCTGGCGGCGGCATGGGTGGGAGCAGCGCAAGCCCGTGTGAC
CTGGACAGGGAGTTCGCGCCCCAAATCGCCCAGCTCCTCGCCACCCCTCCTCTCCAACCC
GCGCAGGAATACTACAATGGGCTCATACAGTCCAGGAAACATGATGGTATAAGAGTGAAC
TTCAGCAGCAAGCATGGGAAAGGTGTTTGTGCGAACAAGGAGTTTGCAGAAGGGGACCTT
ATTCTGAAGGATCAAATATTGGTTGGTGCTCAGCACAGTCTTAACAAGATTGATTGCGCT
GTGTGCAGTTATTGCTTTCGCTTCATTGGTTCTATAGAGTTCCAGATTGGACGAAGATTG
TATTGGCAAAGCGTTGGTTCAAGCAGTGACTGCACTAATAGGAGGCATTGCCATGAGAGT
GATTTGGGATCGAGTGCCAGTTCTTCTGGTGCAACAAAGGAAAACAGTAGTACTTTGCCA
GAAGAGGTCTTAGGATCACTTATTACTGGTGACATGTCACTGCCTTTCACAGACCATTTT
AGTTTGCCTCAAGTTGTTCCTTGTCGTGGATGTGAGGAAGAACGCTACTGCAGCCAATCA
TGTGCTGATTCCGACTGGGAAACTTATCACTCTTTGCTGTGTACTGGATCTAAGACTGAA
CCATCCCAGAGATCTGCTCTTCAGAAATTCATAGAACATGCAAATGGGTCCAATGATATT
TTTCTTGTTGCTGCCAAGGCTATCACTTTCACTCTGCTGAGGTACAAGAAACTCAAAACG
CAGCCTGAATTTCAAAATAACACAGATGAATCAAACTTTTCTTTGCTTATGGAAGCATGG
AAACCACTTTCGATGGGCTACAAAAAGAGGTGGTGGGACTCTGTTGCTTTGCCTGAGGAT
GTTGATTCCTGTGATGAAGATACATTTAGGCAGCAAATTAGGGATCTAGCACTTACGTCA
TTGCAGCTTCTCAAGGATGCTATTTTTGATTCTGAGTGTGCACCCTTGTTCTCACTTGAC
GTGTATGGCCATTTAATTGGCATGTTTGAGCTGAACAATCTTGGTTTGGTTGTTCCGTCT
CCAGTGGAAGACTATTTCATACATATTGATGATCTTCCAGATGATGAGAAGGAGGAAGCT
GAAAAGGTTACAAGGCCATTTCTAGATGCTTTAGGTGAAGACTATGCAGCTCCTTGTGAG
GGGACGGCATTCTTTCCTTTGCAAAGCTGTATGAATCATTCATGTTGTCCAAATGCTAAA
GCATATAAAAGGGATGAGGATACTGATGGTAATGCAGTGATAATTGCTCTGGAGCCTATC
AAGAAGGACGATGAGATTACCATATCCTACATCGATGAGGATGTCTCCTACGAGGAGAGG
CAGGCGGAGCTTGCAGATTATGGATTCATCTGTACGTGCCCTAGGTGCCAAGAAGAAAAG
CCCAACTGAACAAGATCCACAGTTTGGAGGTTCCTGAAATTTATTTTTTTGGTGTGGAAT
ATGCAATTGAAGTTTTGACGACTCCATTTATTTTATTTTTTTTGTCTAGGATATGCAATT
GAGATTTTGACAACTCCAAAAATGTTAGGATAGGATATGCGGAAAGAATGATATGATACG
TACTTATTTGAGTGGATGCTGGATTTTGCTGTGCTAATGTTGGATGCTGCAGAAAGTTTT
TATTCCTTCTGTTCAGTTGAGATTTTTCCTTTTGTGAAAATAACACATTTCTGGGA

CDS

1569 bp

>Os04t0629100-01 Similar to H0303G06.16 protein.
ATAGCTCGAACACGTATGTTCATATCCACACCTCTCCCCCAAGTACGAGACAAGGTCTCG
AGAACAAAACCCCCCAAACCCCACGGCGGCGGCGGCGAGCGGCGGCGGAAGAAGCAGCCG
CAAGAGGCAGCAGCTCGCGCTGGCGGCGGCATGGGTGGGAGCAGCGCAAGCCCGTGTGAC
CTGGACAGGGAGTTCGCGCCCCAAATCGCCCAGCTCCTCGCCACCCCTCCTCTCCAACCC
GCGCAGGAATACTACAATGGGCTCATACAGTCCAGGAAACATGATGGTATAAGAGTGAAC
TTCAGCAGCAAGCATGGGAAAGGTGTTTGTGCGAACAAGGAGTTTGCAGAAGGGGACCTT
ATTCTGAAGGATCAAATATTGGTTGGTGCTCAGCACAGTCTTAACAAGATTGATTGCGCT
GTGTGCAGTTATTGCTTTCGCTTCATTGGTTCTATAGAGTTCCAGATTGGACGAAGATTG
TATTGGCAAAGCGTTGGTTCAAGCAGTGACTGCACTAATAGGAGGCATTGCCATGAGAGT
GATTTGGGATCGAGTGCCAGTTCTTCTGGTGCAACAAAGGAAAACAGTAGTACTTTGCCA
GAAGAGGTCTTAGGATCACTTATTACTGGTGACATGTCACTGCCTTTCACAGACCATTTT
AGTTTGCCTCAAGTTGTTCCTTGTCGTGGATGTGAGGAAGAACGCTACTGCAGCCAATCA
TGTGCTGATTCCGACTGGGAAACTTATCACTCTTTGCTGTGTACTGGATCTAAGACTGAA
CCATCCCAGAGATCTGCTCTTCAGAAATTCATAGAACATGCAAATGGGTCCAATGATATT
TTTCTTGTTGCTGCCAAGGCTATCACTTTCACTCTGCTGAGGTACAAGAAACTCAAAACG
CAGCCTGAATTTCAAAATAACACAGATGAATCAAACTTTTCTTTGCTTATGGAAGCATGG
AAACCACTTTCGATGGGCTACAAAAAGAGGTGGTGGGACTCTGTTGCTTTGCCTGAGGAT
GTTGATTCCTGTGATGAAGATACATTTAGGCAGCAAATTAGGGATCTAGCACTTACGTCA
TTGCAGCTTCTCAAGGATGCTATTTTTGATTCTGAGTGTGCACCCTTGTTCTCACTTGAC
GTGTATGGCCATTTAATTGGCATGTTTGAGCTGAACAATCTTGGTTTGGTTGTTCCGTCT
CCAGTGGAAGACTATTTCATACATATTGATGATCTTCCAGATGATGAGAAGGAGGAAGCT
GAAAAGGTTACAAGGCCATTTCTAGATGCTTTAGGTGAAGACTATGCAGCTCCTTGTGAG
GGGACGGCATTCTTTCCTTTGCAAAGCTGTATGAATCATTCATGTTGTCCAAATGCTAAA
GCATATAAAAGGGATGAGGATACTGATGGTAATGCAGTGATAATTGCTCTGGAGCCTATC
AAGAAGGACGATGAGATTACCATATCCTACATCGATGAGGATGTCTCCTACGAGGAGAGG
CAGGCGGAGCTTGCAGATTATGGATTCATCTGTACGTGCCCTAGGTGCCAAGAAGAAAAG
CCCAACTGA

Protein

523 aa

>Os04t0629100-01 Similar to H0303G06.16 protein.
IARTRMFISTPLPQVRDKVSRTKPPKPHGGGGERRRKKQPQEAAARAGGGMGGSSASPCD
LDREFAPQIAQLLATPPLQPAQEYYNGLIQSRKHDGIRVNFSSKHGKGVCANKEFAEGDL
ILKDQILVGAQHSLNKIDCAVCSYCFRFIGSIEFQIGRRLYWQSVGSSSDCTNRRHCHES
DLGSSASSSGATKENSSTLPEEVLGSLITGDMSLPFTDHFSLPQVVPCRGCEEERYCSQS
CADSDWETYHSLLCTGSKTEPSQRSALQKFIEHANGSNDIFLVAAKAITFTLLRYKKLKT
QPEFQNNTDESNFSLLMEAWKPLSMGYKKRWWDSVALPEDVDSCDEDTFRQQIRDLALTS
LQLLKDAIFDSECAPLFSLDVYGHLIGMFELNNLGLVVPSPVEDYFIHIDDLPDDEKEEA
EKVTRPFLDALGEDYAAPCEGTAFFPLQSCMNHSCCPNAKAYKRDEDTDGNAVIIALEPI
KKDDEITISYIDEDVSYEERQAELADYGFICTCPRCQEEKPN*

CDS

chr04:32007082..32007327 (- strand) : 246 bp

chr04:32006430..32006505 (- strand) : 76 bp

chr04:32006228..32006313 (- strand) : 86 bp

chr04:32005821..32006125 (- strand) : 305 bp

chr04:32005457..32005569 (- strand) : 113 bp

chr04:32005262..32005293 (- strand) : 32 bp

chr04:32004765..32004895 (- strand) : 131 bp

chr04:32004329..32004416 (- strand) : 88 bp

chr04:32004076..32004124 (- strand) : 49 bp

chr04:32003899..32003953 (- strand) : 55 bp

chr04:32003695..32003764 (- strand) : 70 bp

chr04:32003559..32003628 (- strand) : 70 bp

chr04:32003379..32003455 (- strand) : 77 bp

chr04:32003232..32003288 (- strand) : 57 bp

chr04:32003009..32003122 (- strand) : 114 bp

3'UTR

chr04:32002722..32003008 (- strand) : 287 bp

FASTA

>Os04t0629100-01 class=Sequence position=chr04:32002722..32007327 (- strand)
ATAGCTCGAA CACGTATGTT CATATCCACA CCTCTCCCCC AAGTACGAGA CAAGGTCTCG AGAACAAAAC CCCCCAAACC
CCACGGCGGC GGCGGCGAGC GGCGGCGGAA GAAGCAGCCG CAAGAGGCAG CAGCTCGCGC TGGCGGCGGC ATGGGTGGGA
GCAGCGCAAG CCCGTGTGAC CTGGACAGGG AGTTCGCGCC CCAAATCGCC CAGCTCCTCG CCACCCCTCC TCTCCAACCC
GCGCAGGTAC GTTTTCTTTT TCCTTCCCTT GCCCATCCAT CCTCCGGGTC TCAAATCTAT CTGCTTGGGA ATTGCTTGTG
CTGCGATTAT TGTTTTTCCC TGTAGAAAGG TTGGGTAATC ATTGTCGGGA ATTTCGTTAT AAGGAAGTGA TACTATGATG
GGTATATCTT ACTATGATTG GTTTCAGTTA TCTTACTGAG AAAGGAGGAT TTCTTTTTGG TCCGCATGGA TGGTTTTTTT
TAGATTGGTG AGATGAGAGG CGAATTGTTT AGTTTACAAC AGTAACGGTG TAGTTTAATG TTTTATTTGC AGAAGTACAA
TCTTAAGTTT GTCTTTTTTG GGTATCCCAG TTAGTGTGTA GTGAATGTAG CTCGATGGAG GTATCAATTC GACAGAATAG
AAACAATCTT TTGTGTTCTT GGCTTCTTTC TGTGTTGCAG TTACAATTGT CTCCTTGAAG CCAGTAAAAT TGTAGTAAAT
CTTTTATGGC TTTTTTTCTC CTTCCTTGGT TACTTTAGTT CATGTATTGC TGACGATCTG TAGCTCCCAT CTGACACACA
GCTATGCTAC TTTTGTTTTC AGGAATACTA CAATGGGCTC ATACAGTCCA GGAAACATGA TGGTATAAGA GTGAACTTCA
GCAGCAAGCA TGGGAAAGGT ACTGGTTACT GAATACTTAT ATATCTTGTG CAATGCAATC CGGCAAACTT GGAGTGCTTG
TATAAAGTTG GTGTCGGGTA AAAGCCAAGA TACTTAACCA GTTGGTTCTT GCAGGTGTTT GTGCGAACAA GGAGTTTGCA
GAAGGGGACC TTATTCTGAA GGATCAAATA TTGGTTGGTG CTCAGCACAG TCTTAACAAG GTTCGTCTGC TTTTGAAGTG
ATCCTAGGTA TTTGTTCCCT TCTATTTTTT GTGTGAACTG CTCCTCCCTG AAGTGTGGTG TCCATTTTGT GTTTTATTTC
AGATTGATTG CGCTGTGTGC AGTTATTGCT TTCGCTTCAT TGGTTCTATA GAGTTCCAGA TTGGACGAAG ATTGTATTGG
CAAAGCGTTG GTTCAAGCAG TGACTGCACT AATAGGAGGC ATTGCCATGA GAGTGATTTG GGATCGAGTG CCAGTTCTTC
TGGTGCAACA AAGGAAAACA GTAGTACTTT GCCAGAAGAG GTCTTAGGAT CACTTATTAC TGGTGACATG TCACTGCCTT
TCACAGACCA TTTTAGTTTG CCTCAAGTTG TTCCTTGTCG TGGATGTGAG GAAGAACGCT ACTGCAGGTT TGAGTCACTA
ACCATTTTAC AGTTCACACT TTCTTTTGGC TGCAACACCC AAAGATGTTA GGAATTTTGT TTGAGGCATA AATATTTTGT
TGATCAATTC ATTCTCCATC ATAGGTTATA GTTGTCGGTC GTGTTAAAAC TTAAAACCTA ATTATCTTAT CAGAACATGT
AACTTGTTCT TGCCGTCTTA GATAGAAATG TAATCTTGGG GTAAAAACAT AACTTGTTGA TTCTGCATTT TTGTTTAGCC
AATCATGTGC TGATTCCGAC TGGGAAACTT ATCACTCTTT GCTGTGTACT GGATCTAAGA CTGAACCATC CCAGAGATCT
GCTCTTCAGA AATTCATAGA ACATGCAAAT GGTAAGTGCA GTATGCAGTG ATCATTATAT ACCATCATTA CGAATTTATG
TTGTGTTCAC TATTCATTAA ATGCAGCATG CCTAGATCAA TTGTTCCTGA TTAGTGATGA TTGTGATTGA GGTTGTCAGT
CTGTTATCTG CTACTGACCA ATCTTTATTT TCAGGGTCCA ATGATATTTT TCTTGTTGCT GCCAAGGTAT GTGATAGAAA
TATAGATTAA TGTTTAGTGT ACTAAGCACT AAACATCGTG TTATGTGCTC ATCTCAGATT CTAATATTCT CCAAAAGTTT
TATGGGGATA CTAGAACTTT GCCATTGTCC ATGGCTAATA CAAAAAGCAT TCAAGCATCA CACTTGAGTT GGTACTGTTA
TCACTAATGG CTGTCAGCAA TCTACTTATC AATGCACCAG GACAGACTAT TGCACAAGAC GAGTTTTAGT AGCTATATCA
AGAACATCCC CAAACAAAAG ATTCAATTGC AATTTCCTTA TTGCTACCAA TTGCAGTCAA TTTAATATCT CCTGATCATG
ATGCATGAGC TCGATACAAT TTTACATGTC AGGCTATCAC TTTCACTCTG CTGAGGTACA AGAAACTCAA AACGCAGCCT
GAATTTCAAA ATAACACAGA TGAATCAAAC TTTTCTTTGC TTATGGAAGC ATGGAAACCA CTTTCGATGG GCTACAAAAA
GAGGTAAAGT CATGAATTCG CATGCAACTA TTCATCCCCT CTGATAAAGT AGCTGCGCGT ATGGCACTAC CAGCAGTGTT
ATTTTAATGC ACAATCGATA GTTTCTTCAT CAAGTGTATA TCAATAATTC AATGGTACTA GTATATTTCC ACTCTTCTCA
TTTATAACAG TCAATAAGAT CTCTGTTGCA TGGTTGCATA TTTTGTTCTC TTTTTTTGGA TTTGTTGGCA AGATGTTATT
TTCAGCTCAG TGTGGCTTTC ACTACCTTGC TCTAGCTCTA CAAGATCCTT TGAGTTGTTT GCATTGTTGT TCCACCCTAA
TATGTCCCAA AAAAAAAAAA TCTTGTTGCA GGTGGTGGGA CTCTGTTGCT TTGCCTGAGG ATGTTGATTC CTGTGATGAA
GATACATTTA GGCAGCAAAT TAGGGATCTA GCACTTACGG TAATTATGCT GTCACATATT TCATTCTTTT GAAACTATAT
AGGTATTCTA TTCACAATAT TGTGCTCTGA AACGAAGCTT TATTCACTAG CTCGTCAGTT AAAATATAAA AATGGCACAC
AAGAAGTGGT TATTGTTTTG ATTGAAAAGT GTCCCACATA CCAATGGATT GATGGGCAGA TCATTATCTT CTGTGTTTCG
CAGTCATTGC AGCTTCTCAA GGATGCTATT TTTGATTCTG AGTGTGCACC CTGTATCCTT TTTGGCATAT ACTAGATCAG
TTCATATATA TAAATAAGTA GCTTCCCTTC ACATTCAAGT AATCAAGTTT CATTGACTCA CGTAAAAAAA AACGGTCACC
TTGACATTTC CTAGTGTTCT CACTTGACGT GTATGGCCAT TTAATTGGCA TGTTTGAGCT GAACAATCTG TAAGTAAATC
TAATTATTTT TCATTTGTAT ATGTGCATTA CATACTCTGT CATTGTTTCT TTCCATCAAC AGAAATAAGT TCTGTACTGC
ATTTGATGTA ATAACCTCAA TATATTTCCA TCTTTTATTC CAGTGGTTTG GTTGTTCCGT CTCCAGTGGA AGACTATTTC
ATACATATTG ATGATCTTCC AGATGATGAG AAGGTATTTT CACTGGTTAG CCTTAGCTTT TCTTGTGGCA TTGTTAATCT
GAAGTGCAAC ATATCCCAGG AGGAAGCTGA AAAGGTTACA AGGCCATTTC TAGATGCTTT AGGTGAAGAC TATGCAGCTC
CTTGTGAGGG TATGTGGAGC TTCTTCCCAA GTTTATCTCC CCCCACAGTA ATGTCATTTT CTATTTACCC AGCAGTATTC
GTTCATTCTC TTGTGAATTT TCTCGTTGGC AGGGACGGCA TTCTTTCCTT TGCAAAGCTG TATGAATCAT TCATGTTGTC
CAAATGCTAA AGCATATAAA AGGGATGAGG TAATCTATAT TTCTTCCAGT TGATTCGCTC ATTTTTCACA CCAAATTGCC
AGTCAGCAAT CCGACAAAAC CATTGAACTA CCGTTGCAGG ATACTGATGG TAATGCAGTG ATAATTGCTC TGGAGCCTAT
CAAGAAGGAC GATGAGGTAC TGAGCTGTTA ACGCTTATCT CAAATATTTT TTTTCTTGTG CTGCCAGTGA AAAAAGAAAA
CATTGAAAAC GTTGTTTTGC CAAGTACTAA CTGTGAAAAT TCTAGATTAC CATATCCTAC ATCGATGAGG ATGTCTCCTA
CGAGGAGAGG CAGGCGGAGC TTGCAGATTA TGGATTCATC TGTACGTGCC CTAGGTGCCA AGAAGAAAAG CCCAACTGAA
CAAGATCCAC AGTTTGGAGG TTCCTGAAAT TTATTTTTTT GGTGTGGAAT ATGCAATTGA AGTTTTGACG ACTCCATTTA
TTTTATTTTT TTTGTCTAGG ATATGCAATT GAGATTTTGA CAACTCCAAA AATGTTAGGA TAGGATATGC GGAAAGAATG
ATATGATACG TACTTATTTG AGTGGATGCT GGATTTTGCT GTGCTAATGT TGGATGCTGC AGAAAGTTTT TATTCCTTCT
GTTCAGTTGA GATTTTTCCT TTTGTGAAAA TAACACATTT CTGGGA

Locus: Os04g0629100

Loading...

Locus: Os04g0629100

Loading...