Os04t0629100-02

Locus

Os04g0629100

Description

Similar to H0303G06.16 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET21, SDG722

Oryzabase Gene Name Synonym(s)

SET protein 21

Transcript Evidence

AK099320 (DDBJ, Best hit)

Protein Evidence

Q25A43 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

SET domain (IPR001214)

Zinc finger, MYND-type (IPR002893)

Full-length cDNA

J033008O14 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0629100-02)

Others

Oryzabase (13386)

Transcript

1785 bp

>Os04t0629100-02 Similar to H0303G06.16 protein.
AAGGTCTCGAGAACAAAACCCCCCAAACCCCACGGCGGCGGCGGCGAGCGGCGGCGGAAG
AAGCAGCCGCAAGAGGCAGCAGCTCGCGCTGGCGGCGGCATGGGTGGGAGCAGCGCAAGC
CCGTGTGACCTGGACAGGGAGTTCGCGCCCCAAATCGCCCAGCTCCTCGCCACCCCTCCT
CTCCAACCCGCGCAGGAATACTACAATGGGCTCATACAGTCCAGGAAACATGATGGTATA
AGAGTGAACTTCAGCAGCAAGCATGGGAAAGGTGTTTGTGCGAACAAGGAGTTTGCAGAA
GGGGACCTTATTCTGAAGGATCAAATATTGGTTGGTGCTCAGCACAGTCTTAACAAGATT
GATTGCGCTGTGTGCAGTTATTGCTTTCGCTTCATTGGTTCTATAGAGTTCCAGATTGGA
CGAAGATTGTATTGGCAAAGCGTTGGTTCAAGCAGTGACTGCACTAATAGGAGGCATTGC
CATGAGAGTGATTTGGGATCGAGTGCCAGTTCTTCTGGTGCAACAAAGGAAAACAGTAGT
ACTTTGCCAGAAGAGGTCTTAGGATCACTTATTACTGGTGACATGTCACTGCCTTTCACA
GACCATTTTAGTTTGCCTCAAGTTGTTCCTTGTCGTGGATGTGAGGAAGAACGCTACTGC
AGCCAATCATGTGCTGATTCCGACTGGGAAACTTATCACTCTTTGCTGTGTACTGGATCT
AAGACTGAACCATCCCAGAGATCTGCTCTTCAGAAATTCATAGAACATGCAAATGGGTCC
AATGATATTTTTCTTGTTGCTGCCAAGGCTATCACTTTCACTCTGCTGAGGTACAAGAAA
CTCAAAACGCAGCCTGAATTTCAAAATAACACAGATGAATCAAACTTTTCTTTGCTTATG
GAAGCATGGAAACCACTTTCGATGGGCTACAAAAAGAGGTGGTGGGACTCTGTTGCTTTG
CCTGAGGATGTTGATTCCTGTGATGAAGATACATTTAGGCAGCAAATTAGGGATCTAGCA
CTTACGTCATTGCAGCTTCTCAAGGATGCTATTTTTGATTCTGAGTGTGCACCCTTGTTC
TCACTTGACGTGTATGGCCATTTAATTGGCATGTTTGAGCTGAACAATCTTGGTTTGGTT
GTTCCGTCTCCAGTGGAAGACTATTTCATACATATTGATGATCTTCCAGATGATGAGAAG
GAGGAAGCTGAAAAGGTTACAAGGCCATTTCTAGATGCTTTAGGTGAAGACTATGCAGCT
CCTTGTGAGGGGACGGCATTCTTTCCTTTGCAAAGCTGTATGAATCATTCATGTTGTCCA
AATGCTAAAGCATATAAAAGGGATGAGGATACTGATGGTAATGCAGTGATAATTGCTCTG
GAGCCTATCAAGAAGGACGATGAGATTACCATATCCTACATCGATGAGGATGTCTCCTAC
GAGGAGAGGCAGGCGGAGCTTGCAGATTATGGATTCATCTGTACGTGCCCTAGGTGCCAA
GAAGAAAAGCCCAACTGAACAAGATCCACAGTTTGGAGGTTCCTGAAATTTATTTTTTTG
GTGTGGAATATGCAATTGAAGTTTTGACGACTCCATTTATTTTATTTTTTTTGTCTAGGA
TATGCAATTGAGATTTTGACAACTCCAAAAATGTTAGGATAGGATATGCGGAAAGAATGA
TATGATACGTACTTATTTGAGTGGATGCTGGATTTTGCTGTGCTAATGTTGGATGCTGCA
GAAAGTTTTTATTCCTTCTGTTCAGTTGAGATTTTTCCTTTTGTG

CDS

1518 bp

>Os04t0629100-02 Similar to H0303G06.16 protein.
AAGGTCTCGAGAACAAAACCCCCCAAACCCCACGGCGGCGGCGGCGAGCGGCGGCGGAAG
AAGCAGCCGCAAGAGGCAGCAGCTCGCGCTGGCGGCGGCATGGGTGGGAGCAGCGCAAGC
CCGTGTGACCTGGACAGGGAGTTCGCGCCCCAAATCGCCCAGCTCCTCGCCACCCCTCCT
CTCCAACCCGCGCAGGAATACTACAATGGGCTCATACAGTCCAGGAAACATGATGGTATA
AGAGTGAACTTCAGCAGCAAGCATGGGAAAGGTGTTTGTGCGAACAAGGAGTTTGCAGAA
GGGGACCTTATTCTGAAGGATCAAATATTGGTTGGTGCTCAGCACAGTCTTAACAAGATT
GATTGCGCTGTGTGCAGTTATTGCTTTCGCTTCATTGGTTCTATAGAGTTCCAGATTGGA
CGAAGATTGTATTGGCAAAGCGTTGGTTCAAGCAGTGACTGCACTAATAGGAGGCATTGC
CATGAGAGTGATTTGGGATCGAGTGCCAGTTCTTCTGGTGCAACAAAGGAAAACAGTAGT
ACTTTGCCAGAAGAGGTCTTAGGATCACTTATTACTGGTGACATGTCACTGCCTTTCACA
GACCATTTTAGTTTGCCTCAAGTTGTTCCTTGTCGTGGATGTGAGGAAGAACGCTACTGC
AGCCAATCATGTGCTGATTCCGACTGGGAAACTTATCACTCTTTGCTGTGTACTGGATCT
AAGACTGAACCATCCCAGAGATCTGCTCTTCAGAAATTCATAGAACATGCAAATGGGTCC
AATGATATTTTTCTTGTTGCTGCCAAGGCTATCACTTTCACTCTGCTGAGGTACAAGAAA
CTCAAAACGCAGCCTGAATTTCAAAATAACACAGATGAATCAAACTTTTCTTTGCTTATG
GAAGCATGGAAACCACTTTCGATGGGCTACAAAAAGAGGTGGTGGGACTCTGTTGCTTTG
CCTGAGGATGTTGATTCCTGTGATGAAGATACATTTAGGCAGCAAATTAGGGATCTAGCA
CTTACGTCATTGCAGCTTCTCAAGGATGCTATTTTTGATTCTGAGTGTGCACCCTTGTTC
TCACTTGACGTGTATGGCCATTTAATTGGCATGTTTGAGCTGAACAATCTTGGTTTGGTT
GTTCCGTCTCCAGTGGAAGACTATTTCATACATATTGATGATCTTCCAGATGATGAGAAG
GAGGAAGCTGAAAAGGTTACAAGGCCATTTCTAGATGCTTTAGGTGAAGACTATGCAGCT
CCTTGTGAGGGGACGGCATTCTTTCCTTTGCAAAGCTGTATGAATCATTCATGTTGTCCA
AATGCTAAAGCATATAAAAGGGATGAGGATACTGATGGTAATGCAGTGATAATTGCTCTG
GAGCCTATCAAGAAGGACGATGAGATTACCATATCCTACATCGATGAGGATGTCTCCTAC
GAGGAGAGGCAGGCGGAGCTTGCAGATTATGGATTCATCTGTACGTGCCCTAGGTGCCAA
GAAGAAAAGCCCAACTGA

Protein

506 aa

>Os04t0629100-02 Similar to H0303G06.16 protein.
KVSRTKPPKPHGGGGERRRKKQPQEAAARAGGGMGGSSASPCDLDREFAPQIAQLLATPP
LQPAQEYYNGLIQSRKHDGIRVNFSSKHGKGVCANKEFAEGDLILKDQILVGAQHSLNKI
DCAVCSYCFRFIGSIEFQIGRRLYWQSVGSSSDCTNRRHCHESDLGSSASSSGATKENSS
TLPEEVLGSLITGDMSLPFTDHFSLPQVVPCRGCEEERYCSQSCADSDWETYHSLLCTGS
KTEPSQRSALQKFIEHANGSNDIFLVAAKAITFTLLRYKKLKTQPEFQNNTDESNFSLLM
EAWKPLSMGYKKRWWDSVALPEDVDSCDEDTFRQQIRDLALTSLQLLKDAIFDSECAPLF
SLDVYGHLIGMFELNNLGLVVPSPVEDYFIHIDDLPDDEKEEAEKVTRPFLDALGEDYAA
PCEGTAFFPLQSCMNHSCCPNAKAYKRDEDTDGNAVIIALEPIKKDDEITISYIDEDVSY
EERQAELADYGFICTCPRCQEEKPN*

CDS

chr04:32007082..32007276 (- strand) : 195 bp

chr04:32006430..32006505 (- strand) : 76 bp

chr04:32006228..32006313 (- strand) : 86 bp

chr04:32005821..32006125 (- strand) : 305 bp

chr04:32005457..32005569 (- strand) : 113 bp

chr04:32005262..32005293 (- strand) : 32 bp

chr04:32004765..32004895 (- strand) : 131 bp

chr04:32004329..32004416 (- strand) : 88 bp

chr04:32004076..32004124 (- strand) : 49 bp

chr04:32003899..32003953 (- strand) : 55 bp

chr04:32003695..32003764 (- strand) : 70 bp

chr04:32003559..32003628 (- strand) : 70 bp

chr04:32003379..32003455 (- strand) : 77 bp

chr04:32003232..32003288 (- strand) : 57 bp

chr04:32003009..32003122 (- strand) : 114 bp

3'UTR

chr04:32002742..32003008 (- strand) : 267 bp

FASTA

>Os04t0629100-02 class=Sequence position=chr04:32002742..32007276 (- strand)
AAGGTCTCGA GAACAAAACC CCCCAAACCC CACGGCGGCG GCGGCGAGCG GCGGCGGAAG AAGCAGCCGC AAGAGGCAGC
AGCTCGCGCT GGCGGCGGCA TGGGTGGGAG CAGCGCAAGC CCGTGTGACC TGGACAGGGA GTTCGCGCCC CAAATCGCCC
AGCTCCTCGC CACCCCTCCT CTCCAACCCG CGCAGGTACG TTTTCTTTTT CCTTCCCTTG CCCATCCATC CTCCGGGTCT
CAAATCTATC TGCTTGGGAA TTGCTTGTGC TGCGATTATT GTTTTTCCCT GTAGAAAGGT TGGGTAATCA TTGTCGGGAA
TTTCGTTATA AGGAAGTGAT ACTATGATGG GTATATCTTA CTATGATTGG TTTCAGTTAT CTTACTGAGA AAGGAGGATT
TCTTTTTGGT CCGCATGGAT GGTTTTTTTT AGATTGGTGA GATGAGAGGC GAATTGTTTA GTTTACAACA GTAACGGTGT
AGTTTAATGT TTTATTTGCA GAAGTACAAT CTTAAGTTTG TCTTTTTTGG GTATCCCAGT TAGTGTGTAG TGAATGTAGC
TCGATGGAGG TATCAATTCG ACAGAATAGA AACAATCTTT TGTGTTCTTG GCTTCTTTCT GTGTTGCAGT TACAATTGTC
TCCTTGAAGC CAGTAAAATT GTAGTAAATC TTTTATGGCT TTTTTTCTCC TTCCTTGGTT ACTTTAGTTC ATGTATTGCT
GACGATCTGT AGCTCCCATC TGACACACAG CTATGCTACT TTTGTTTTCA GGAATACTAC AATGGGCTCA TACAGTCCAG
GAAACATGAT GGTATAAGAG TGAACTTCAG CAGCAAGCAT GGGAAAGGTA CTGGTTACTG AATACTTATA TATCTTGTGC
AATGCAATCC GGCAAACTTG GAGTGCTTGT ATAAAGTTGG TGTCGGGTAA AAGCCAAGAT ACTTAACCAG TTGGTTCTTG
CAGGTGTTTG TGCGAACAAG GAGTTTGCAG AAGGGGACCT TATTCTGAAG GATCAAATAT TGGTTGGTGC TCAGCACAGT
CTTAACAAGG TTCGTCTGCT TTTGAAGTGA TCCTAGGTAT TTGTTCCCTT CTATTTTTTG TGTGAACTGC TCCTCCCTGA
AGTGTGGTGT CCATTTTGTG TTTTATTTCA GATTGATTGC GCTGTGTGCA GTTATTGCTT TCGCTTCATT GGTTCTATAG
AGTTCCAGAT TGGACGAAGA TTGTATTGGC AAAGCGTTGG TTCAAGCAGT GACTGCACTA ATAGGAGGCA TTGCCATGAG
AGTGATTTGG GATCGAGTGC CAGTTCTTCT GGTGCAACAA AGGAAAACAG TAGTACTTTG CCAGAAGAGG TCTTAGGATC
ACTTATTACT GGTGACATGT CACTGCCTTT CACAGACCAT TTTAGTTTGC CTCAAGTTGT TCCTTGTCGT GGATGTGAGG
AAGAACGCTA CTGCAGGTTT GAGTCACTAA CCATTTTACA GTTCACACTT TCTTTTGGCT GCAACACCCA AAGATGTTAG
GAATTTTGTT TGAGGCATAA ATATTTTGTT GATCAATTCA TTCTCCATCA TAGGTTATAG TTGTCGGTCG TGTTAAAACT
TAAAACCTAA TTATCTTATC AGAACATGTA ACTTGTTCTT GCCGTCTTAG ATAGAAATGT AATCTTGGGG TAAAAACATA
ACTTGTTGAT TCTGCATTTT TGTTTAGCCA ATCATGTGCT GATTCCGACT GGGAAACTTA TCACTCTTTG CTGTGTACTG
GATCTAAGAC TGAACCATCC CAGAGATCTG CTCTTCAGAA ATTCATAGAA CATGCAAATG GTAAGTGCAG TATGCAGTGA
TCATTATATA CCATCATTAC GAATTTATGT TGTGTTCACT ATTCATTAAA TGCAGCATGC CTAGATCAAT TGTTCCTGAT
TAGTGATGAT TGTGATTGAG GTTGTCAGTC TGTTATCTGC TACTGACCAA TCTTTATTTT CAGGGTCCAA TGATATTTTT
CTTGTTGCTG CCAAGGTATG TGATAGAAAT ATAGATTAAT GTTTAGTGTA CTAAGCACTA AACATCGTGT TATGTGCTCA
TCTCAGATTC TAATATTCTC CAAAAGTTTT ATGGGGATAC TAGAACTTTG CCATTGTCCA TGGCTAATAC AAAAAGCATT
CAAGCATCAC ACTTGAGTTG GTACTGTTAT CACTAATGGC TGTCAGCAAT CTACTTATCA ATGCACCAGG ACAGACTATT
GCACAAGACG AGTTTTAGTA GCTATATCAA GAACATCCCC AAACAAAAGA TTCAATTGCA ATTTCCTTAT TGCTACCAAT
TGCAGTCAAT TTAATATCTC CTGATCATGA TGCATGAGCT CGATACAATT TTACATGTCA GGCTATCACT TTCACTCTGC
TGAGGTACAA GAAACTCAAA ACGCAGCCTG AATTTCAAAA TAACACAGAT GAATCAAACT TTTCTTTGCT TATGGAAGCA
TGGAAACCAC TTTCGATGGG CTACAAAAAG AGGTAAAGTC ATGAATTCGC ATGCAACTAT TCATCCCCTC TGATAAAGTA
GCTGCGCGTA TGGCACTACC AGCAGTGTTA TTTTAATGCA CAATCGATAG TTTCTTCATC AAGTGTATAT CAATAATTCA
ATGGTACTAG TATATTTCCA CTCTTCTCAT TTATAACAGT CAATAAGATC TCTGTTGCAT GGTTGCATAT TTTGTTCTCT
TTTTTTGGAT TTGTTGGCAA GATGTTATTT TCAGCTCAGT GTGGCTTTCA CTACCTTGCT CTAGCTCTAC AAGATCCTTT
GAGTTGTTTG CATTGTTGTT CCACCCTAAT ATGTCCCAAA AAAAAAAAAT CTTGTTGCAG GTGGTGGGAC TCTGTTGCTT
TGCCTGAGGA TGTTGATTCC TGTGATGAAG ATACATTTAG GCAGCAAATT AGGGATCTAG CACTTACGGT AATTATGCTG
TCACATATTT CATTCTTTTG AAACTATATA GGTATTCTAT TCACAATATT GTGCTCTGAA ACGAAGCTTT ATTCACTAGC
TCGTCAGTTA AAATATAAAA ATGGCACACA AGAAGTGGTT ATTGTTTTGA TTGAAAAGTG TCCCACATAC CAATGGATTG
ATGGGCAGAT CATTATCTTC TGTGTTTCGC AGTCATTGCA GCTTCTCAAG GATGCTATTT TTGATTCTGA GTGTGCACCC
TGTATCCTTT TTGGCATATA CTAGATCAGT TCATATATAT AAATAAGTAG CTTCCCTTCA CATTCAAGTA ATCAAGTTTC
ATTGACTCAC GTAAAAAAAA ACGGTCACCT TGACATTTCC TAGTGTTCTC ACTTGACGTG TATGGCCATT TAATTGGCAT
GTTTGAGCTG AACAATCTGT AAGTAAATCT AATTATTTTT CATTTGTATA TGTGCATTAC ATACTCTGTC ATTGTTTCTT
TCCATCAACA GAAATAAGTT CTGTACTGCA TTTGATGTAA TAACCTCAAT ATATTTCCAT CTTTTATTCC AGTGGTTTGG
TTGTTCCGTC TCCAGTGGAA GACTATTTCA TACATATTGA TGATCTTCCA GATGATGAGA AGGTATTTTC ACTGGTTAGC
CTTAGCTTTT CTTGTGGCAT TGTTAATCTG AAGTGCAACA TATCCCAGGA GGAAGCTGAA AAGGTTACAA GGCCATTTCT
AGATGCTTTA GGTGAAGACT ATGCAGCTCC TTGTGAGGGT ATGTGGAGCT TCTTCCCAAG TTTATCTCCC CCCACAGTAA
TGTCATTTTC TATTTACCCA GCAGTATTCG TTCATTCTCT TGTGAATTTT CTCGTTGGCA GGGACGGCAT TCTTTCCTTT
GCAAAGCTGT ATGAATCATT CATGTTGTCC AAATGCTAAA GCATATAAAA GGGATGAGGT AATCTATATT TCTTCCAGTT
GATTCGCTCA TTTTTCACAC CAAATTGCCA GTCAGCAATC CGACAAAACC ATTGAACTAC CGTTGCAGGA TACTGATGGT
AATGCAGTGA TAATTGCTCT GGAGCCTATC AAGAAGGACG ATGAGGTACT GAGCTGTTAA CGCTTATCTC AAATATTTTT
TTTCTTGTGC TGCCAGTGAA AAAAGAAAAC ATTGAAAACG TTGTTTTGCC AAGTACTAAC TGTGAAAATT CTAGATTACC
ATATCCTACA TCGATGAGGA TGTCTCCTAC GAGGAGAGGC AGGCGGAGCT TGCAGATTAT GGATTCATCT GTACGTGCCC
TAGGTGCCAA GAAGAAAAGC CCAACTGAAC AAGATCCACA GTTTGGAGGT TCCTGAAATT TATTTTTTTG GTGTGGAATA
TGCAATTGAA GTTTTGACGA CTCCATTTAT TTTATTTTTT TTGTCTAGGA TATGCAATTG AGATTTTGAC AACTCCAAAA
ATGTTAGGAT AGGATATGCG GAAAGAATGA TATGATACGT ACTTATTTGA GTGGATGCTG GATTTTGCTG TGCTAATGTT
GGATGCTGCA GAAAGTTTTT ATTCCTTCTG TTCAGTTGAG ATTTTTCCTT TTGTG

Locus: Os04g0629100

Loading...

Locus: Os04g0629100

Loading...