Os04t0640900-01

Locus

Os04g0640900

Description

Similar to ORW1943Ba0077G13.1 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IIP5

CGSNL Gene Name

ILA1 INTERACTING PROTEIN 5

Oryzabase Gene Symbol Synonym(s)

IIP5

Oryzabase Gene Name Synonym(s)

ILA1 interacting protein 5

Transcript Evidence

AK062582 (DDBJ, Best hit)

Protein Evidence

F2QA78 (UniProt)

Literature

Note

  • Exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

001-100-C11 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0640900-01)

Others

Oryzabase (10226)

Transcript

2274 bp

>Os04t0640900-01 Similar to ORW1943Ba0077G13.1 protein.
GTTTATACTATATGCTTCCTTTATGGTGAAGTTATAAAACTGGGATTCTGATGGTTTGAC
GAAAGCTCTTGGTCCCCAAACAATACTAAACTCCTTTTTCTGTCACATCTTACCGTATTT
ATATTAAGAAGGATGGACCTTAATATGACAAATCTTTGGTTTCATGGGAAGGAACATATA
GCTGCTTCGCCATTCCCACAAGTTGCAACATCAATGAACTTCACTTGCCTTGGCAGCTCA
AAAACAATCGAGACTTCTAAAAAAATGTTTCAGCAGAGCGATCAAAGCTTGTCTATTCCT
GATGATGGATGCAGGCTTGTCCTTGGACTTGGACCAACACCTAATCTACATTATGCTGAT
AATGAGTCATCCGGTGGCAACAGGGATAAAGAATCTGCAAATTTGTTCAGCCAACATTTT
GCCATAGCCGATCATGGTCTGATGTTGGGCATTTCGAGAGGTGGCACAAGAAATTTTCAA
GCCACAACAATGATCGAGAAGTATTCACATCAAAATAGAAATGGTATCGTCTTCCCACTT
ACTGATGAAGGATCAACTTCAGCTAAAAGGAAACCAGGTGGTTATGTGCTGCCACTTCTG
TTTGCTCCAAGATCAGATGATATCTGTCCCAATGGAACACCACCAGTGACCGATATTCAA
CATGTTGAAACTGTAGATGATTGTGACGATGATCACATTACGTCTCTTAATCAGCAGAAG
GTTCAGATTAGCCCCGAGCCTTCAGCAACAACTGATTGTTCTTTTGCTGCAACTTCAGAT
ATGATATTCTCCTCAACTAGCACGGAGCAGAGAAGTCACCAACGACATCCTAAGAAGTGT
AGGTTCAATGGGTGTTCAAAAGGAGCAAGAGGGGCAACAGGGCTCTGCATTTCCCATGGT
GGTGGTCAGCGGTGTCAAAAGCCTGGTTGCAACAAAGGTGCCGAGAGCCGAACAGCTTAC
TGCAAATCTCATGGTGGAGGGAAACGGTGTCAGGAGCTAGGCTGCACCAAAAGTGCTGAA
GGGAAGACTGAGTTCTGCATTGCTCATGGTGGTGGGCGTCGATGCGGAACTCCGGGGTGT
ACGAAGGCAGCAAGGGGAAGATCAGGATTTTGCATAAAACATGGTGGAGGGAAGAGATGC
AGGGTAGAGGGATGCAGCAGGAGTGCCGAAGGACAGTTTGGGTTGTGCATCTCACATGGA
GGTGGTCGCCGGTGTCAGTACCCGAACTGCAGTAAGGGAGCACAAGGAGGCACCATGTTT
TGCAAGTCCCATGGTGGAGGCAAACGGTGTATATTTGAAGGCTGTACTAAAGGTGCCGAG
GGCAACACGCTGCTATGTAAAGGGCACGGTGGTGGTAAGAGGTGCCTCTTTGAGGGAGGT
GGTGTCTGTCCTAAAAGTGTTCATGGTGGAACTAGCTTCTGCGTCGCTCATGGAGGCGGC
AAACGCTGTTCTGTACCAGGATGTACCAAGAGCGCCCGTGGTCGCACTGATTGCTGCGTG
AGGCATGGTGGTGGCAAGCGTTGCAAGGTTGACGGTTGCGACAAGAGTGCTCAGGGGAGC
ACGGACTTCTGCAAGGCGCATGGAGGCGGCAAACGATGCGCTTGGAGCACCGGCTGTGAG
AGGTTTGCAAGGGGAAGGAGTGGGTTATGTGCTGCACATGGAACCCTGATGGCTTCAAAG
CAAGTGCCTGAATCTGAGCACAGCAGAGGCATGATCAGGAACAGCCTCTTCAGCAAGATG
GTCTCTGCATCCTCGATGACGGCTGGTGCTAGCATGGATCATGCCATCTCTTCTTCTCTC
CCTGGTGCCTCGTCGGATCGCGGTGAGTCCTTGGAAGAGATGCGGAACGGCAAGCTCCTG
ATACCGCATCAGGTCCTGGTTCCTGGTTCAATGAGGCCATCTTCTTCGCATGGCAAAGGT
CAAGAGGACGGAGGGAGCCAGGAGCAGCAGTGCTTCGGGTTCGTCGTGCCGGAGGGGAGG
GTTCATGGTGGGGGCCTGATGTCCATGCTTGGAGCTGGAGGCAATCTTGACGATCCGAAG
GACTGAATTTTGCTGAAAATGTTAAAGTTGCAGCTATTTTTATGCTGTCATTTATGATTT
CTGCATCTAGAATCTATAAGATTTCAGATCACCATTGCACTATGCTGTCAAGCATGACTG
CTTGATCGAAACTGAATTCTGAATTATGTGGCTTAGGCCTTGTATAAAGTATTTTGTCAT
TCATATGGCACTTACATACACAAAGAGCAGAATACCTGAAGAGCTGTTTGATTG

CDS

1914 bp

>Os04t0640900-01 Similar to ORW1943Ba0077G13.1 protein.
ATGGACCTTAATATGACAAATCTTTGGTTTCATGGGAAGGAACATATAGCTGCTTCGCCA
TTCCCACAAGTTGCAACATCAATGAACTTCACTTGCCTTGGCAGCTCAAAAACAATCGAG
ACTTCTAAAAAAATGTTTCAGCAGAGCGATCAAAGCTTGTCTATTCCTGATGATGGATGC
AGGCTTGTCCTTGGACTTGGACCAACACCTAATCTACATTATGCTGATAATGAGTCATCC
GGTGGCAACAGGGATAAAGAATCTGCAAATTTGTTCAGCCAACATTTTGCCATAGCCGAT
CATGGTCTGATGTTGGGCATTTCGAGAGGTGGCACAAGAAATTTTCAAGCCACAACAATG
ATCGAGAAGTATTCACATCAAAATAGAAATGGTATCGTCTTCCCACTTACTGATGAAGGA
TCAACTTCAGCTAAAAGGAAACCAGGTGGTTATGTGCTGCCACTTCTGTTTGCTCCAAGA
TCAGATGATATCTGTCCCAATGGAACACCACCAGTGACCGATATTCAACATGTTGAAACT
GTAGATGATTGTGACGATGATCACATTACGTCTCTTAATCAGCAGAAGGTTCAGATTAGC
CCCGAGCCTTCAGCAACAACTGATTGTTCTTTTGCTGCAACTTCAGATATGATATTCTCC
TCAACTAGCACGGAGCAGAGAAGTCACCAACGACATCCTAAGAAGTGTAGGTTCAATGGG
TGTTCAAAAGGAGCAAGAGGGGCAACAGGGCTCTGCATTTCCCATGGTGGTGGTCAGCGG
TGTCAAAAGCCTGGTTGCAACAAAGGTGCCGAGAGCCGAACAGCTTACTGCAAATCTCAT
GGTGGAGGGAAACGGTGTCAGGAGCTAGGCTGCACCAAAAGTGCTGAAGGGAAGACTGAG
TTCTGCATTGCTCATGGTGGTGGGCGTCGATGCGGAACTCCGGGGTGTACGAAGGCAGCA
AGGGGAAGATCAGGATTTTGCATAAAACATGGTGGAGGGAAGAGATGCAGGGTAGAGGGA
TGCAGCAGGAGTGCCGAAGGACAGTTTGGGTTGTGCATCTCACATGGAGGTGGTCGCCGG
TGTCAGTACCCGAACTGCAGTAAGGGAGCACAAGGAGGCACCATGTTTTGCAAGTCCCAT
GGTGGAGGCAAACGGTGTATATTTGAAGGCTGTACTAAAGGTGCCGAGGGCAACACGCTG
CTATGTAAAGGGCACGGTGGTGGTAAGAGGTGCCTCTTTGAGGGAGGTGGTGTCTGTCCT
AAAAGTGTTCATGGTGGAACTAGCTTCTGCGTCGCTCATGGAGGCGGCAAACGCTGTTCT
GTACCAGGATGTACCAAGAGCGCCCGTGGTCGCACTGATTGCTGCGTGAGGCATGGTGGT
GGCAAGCGTTGCAAGGTTGACGGTTGCGACAAGAGTGCTCAGGGGAGCACGGACTTCTGC
AAGGCGCATGGAGGCGGCAAACGATGCGCTTGGAGCACCGGCTGTGAGAGGTTTGCAAGG
GGAAGGAGTGGGTTATGTGCTGCACATGGAACCCTGATGGCTTCAAAGCAAGTGCCTGAA
TCTGAGCACAGCAGAGGCATGATCAGGAACAGCCTCTTCAGCAAGATGGTCTCTGCATCC
TCGATGACGGCTGGTGCTAGCATGGATCATGCCATCTCTTCTTCTCTCCCTGGTGCCTCG
TCGGATCGCGGTGAGTCCTTGGAAGAGATGCGGAACGGCAAGCTCCTGATACCGCATCAG
GTCCTGGTTCCTGGTTCAATGAGGCCATCTTCTTCGCATGGCAAAGGTCAAGAGGACGGA
GGGAGCCAGGAGCAGCAGTGCTTCGGGTTCGTCGTGCCGGAGGGGAGGGTTCATGGTGGG
GGCCTGATGTCCATGCTTGGAGCTGGAGGCAATCTTGACGATCCGAAGGACTGA

Protein

638 aa

>Os04t0640900-01 Similar to ORW1943Ba0077G13.1 protein.
MDLNMTNLWFHGKEHIAASPFPQVATSMNFTCLGSSKTIETSKKMFQQSDQSLSIPDDGC
RLVLGLGPTPNLHYADNESSGGNRDKESANLFSQHFAIADHGLMLGISRGGTRNFQATTM
IEKYSHQNRNGIVFPLTDEGSTSAKRKPGGYVLPLLFAPRSDDICPNGTPPVTDIQHVET
VDDCDDDHITSLNQQKVQISPEPSATTDCSFAATSDMIFSSTSTEQRSHQRHPKKCRFNG
CSKGARGATGLCISHGGGQRCQKPGCNKGAESRTAYCKSHGGGKRCQELGCTKSAEGKTE
FCIAHGGGRRCGTPGCTKAARGRSGFCIKHGGGKRCRVEGCSRSAEGQFGLCISHGGGRR
CQYPNCSKGAQGGTMFCKSHGGGKRCIFEGCTKGAEGNTLLCKGHGGGKRCLFEGGGVCP
KSVHGGTSFCVAHGGGKRCSVPGCTKSARGRTDCCVRHGGGKRCKVDGCDKSAQGSTDFC
KAHGGGKRCAWSTGCERFARGRSGLCAAHGTLMASKQVPESEHSRGMIRNSLFSKMVSAS
SMTAGASMDHAISSSLPGASSDRGESLEEMRNGKLLIPHQVLVPGSMRPSSSHGKGQEDG
GSQEQQCFGFVVPEGRVHGGGLMSMLGAGGNLDDPKD*

5'UTR

chr04:32606375..32606506 (+ strand) : 132 bp

CDS

chr04:32606507..32608420 (+ strand) : 1914 bp

3'UTR

chr04:32608421..32608648 (+ strand) : 228 bp

FASTA

>Os04t0640900-01 class=Sequence position=chr04:32606375..32608648 (+ strand)
GTTTATACTA TATGCTTCCT TTATGGTGAA GTTATAAAAC TGGGATTCTG ATGGTTTGAC GAAAGCTCTT GGTCCCCAAA
CAATACTAAA CTCCTTTTTC TGTCACATCT TACCGTATTT ATATTAAGAA GGATGGACCT TAATATGACA AATCTTTGGT
TTCATGGGAA GGAACATATA GCTGCTTCGC CATTCCCACA AGTTGCAACA TCAATGAACT TCACTTGCCT TGGCAGCTCA
AAAACAATCG AGACTTCTAA AAAAATGTTT CAGCAGAGCG ATCAAAGCTT GTCTATTCCT GATGATGGAT GCAGGCTTGT
CCTTGGACTT GGACCAACAC CTAATCTACA TTATGCTGAT AATGAGTCAT CCGGTGGCAA CAGGGATAAA GAATCTGCAA
ATTTGTTCAG CCAACATTTT GCCATAGCCG ATCATGGTCT GATGTTGGGC ATTTCGAGAG GTGGCACAAG AAATTTTCAA
GCCACAACAA TGATCGAGAA GTATTCACAT CAAAATAGAA ATGGTATCGT CTTCCCACTT ACTGATGAAG GATCAACTTC
AGCTAAAAGG AAACCAGGTG GTTATGTGCT GCCACTTCTG TTTGCTCCAA GATCAGATGA TATCTGTCCC AATGGAACAC
CACCAGTGAC CGATATTCAA CATGTTGAAA CTGTAGATGA TTGTGACGAT GATCACATTA CGTCTCTTAA TCAGCAGAAG
GTTCAGATTA GCCCCGAGCC TTCAGCAACA ACTGATTGTT CTTTTGCTGC AACTTCAGAT ATGATATTCT CCTCAACTAG
CACGGAGCAG AGAAGTCACC AACGACATCC TAAGAAGTGT AGGTTCAATG GGTGTTCAAA AGGAGCAAGA GGGGCAACAG
GGCTCTGCAT TTCCCATGGT GGTGGTCAGC GGTGTCAAAA GCCTGGTTGC AACAAAGGTG CCGAGAGCCG AACAGCTTAC
TGCAAATCTC ATGGTGGAGG GAAACGGTGT CAGGAGCTAG GCTGCACCAA AAGTGCTGAA GGGAAGACTG AGTTCTGCAT
TGCTCATGGT GGTGGGCGTC GATGCGGAAC TCCGGGGTGT ACGAAGGCAG CAAGGGGAAG ATCAGGATTT TGCATAAAAC
ATGGTGGAGG GAAGAGATGC AGGGTAGAGG GATGCAGCAG GAGTGCCGAA GGACAGTTTG GGTTGTGCAT CTCACATGGA
GGTGGTCGCC GGTGTCAGTA CCCGAACTGC AGTAAGGGAG CACAAGGAGG CACCATGTTT TGCAAGTCCC ATGGTGGAGG
CAAACGGTGT ATATTTGAAG GCTGTACTAA AGGTGCCGAG GGCAACACGC TGCTATGTAA AGGGCACGGT GGTGGTAAGA
GGTGCCTCTT TGAGGGAGGT GGTGTCTGTC CTAAAAGTGT TCATGGTGGA ACTAGCTTCT GCGTCGCTCA TGGAGGCGGC
AAACGCTGTT CTGTACCAGG ATGTACCAAG AGCGCCCGTG GTCGCACTGA TTGCTGCGTG AGGCATGGTG GTGGCAAGCG
TTGCAAGGTT GACGGTTGCG ACAAGAGTGC TCAGGGGAGC ACGGACTTCT GCAAGGCGCA TGGAGGCGGC AAACGATGCG
CTTGGAGCAC CGGCTGTGAG AGGTTTGCAA GGGGAAGGAG TGGGTTATGT GCTGCACATG GAACCCTGAT GGCTTCAAAG
CAAGTGCCTG AATCTGAGCA CAGCAGAGGC ATGATCAGGA ACAGCCTCTT CAGCAAGATG GTCTCTGCAT CCTCGATGAC
GGCTGGTGCT AGCATGGATC ATGCCATCTC TTCTTCTCTC CCTGGTGCCT CGTCGGATCG CGGTGAGTCC TTGGAAGAGA
TGCGGAACGG CAAGCTCCTG ATACCGCATC AGGTCCTGGT TCCTGGTTCA ATGAGGCCAT CTTCTTCGCA TGGCAAAGGT
CAAGAGGACG GAGGGAGCCA GGAGCAGCAG TGCTTCGGGT TCGTCGTGCC GGAGGGGAGG GTTCATGGTG GGGGCCTGAT
GTCCATGCTT GGAGCTGGAG GCAATCTTGA CGATCCGAAG GACTGAATTT TGCTGAAAAT GTTAAAGTTG CAGCTATTTT
TATGCTGTCA TTTATGATTT CTGCATCTAG AATCTATAAG ATTTCAGATC ACCATTGCAC TATGCTGTCA AGCATGACTG
CTTGATCGAA ACTGAATTCT GAATTATGTG GCTTAGGCCT TGTATAAAGT ATTTTGTCAT TCATATGGCA CTTACATACA
CAAAGAGCAG AATACCTGAA GAGCTGTTTG ATTG

Locus: Os04g0640900

Loading...

Locus: Os04g0640900

Loading...