Os04t0641700-00

Locus

Os04g0641700

Description

Similar to H0423H10.4 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ILI1

CGSNL Gene Name

INCREASED LEAF INCLINATION 1

Oryzabase Gene Symbol Synonym(s)

ILI1, OsbHLH154, OsILI1

Oryzabase Gene Name Synonym(s)

Increased Leaf Inclination1, INCREASED LEAF INCLINATION 1, basic helix-loop-helix protein 154

Transcript Evidence

FP096598 (DDBJ)

Protein Evidence

Q9FSQ9 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Helix-loop-helix DNA-binding (IPR011598)

Expression Databases

TENOR (Os04t0641700-00)

Others

Oryzabase (10945)

Transcript

777 bp

>Os04t0641700-00 Similar to H0423H10.4 protein.
TTGCAACCATGTCGAGCAGCCGGAGGTCGCGCTCACGGCGAGCCGGGAGCTCGGTGCCGT
CGTCGTCGTCGTCGTCGAGGACGTCGATCTCGGAGGACCAGATCGCCGAGCTTCTCTCCA
AGCTTCAGGCCCTGCTCCCGGAGTCTCAGGCTCGCAATGGCGCCCATAGGGGCTCGGCGG
CGAGGGTTTTGCAGGAGACGTGCAGCTACATCAGGAGCCTGCACCAGGAGGTGGACAACC
TCAGCGAGACGCTCGCTCAGCTGCTCGCCTCCCCCGACGTCACCAGCGACCAGGCGGCCG
TCATCAGGAGCCTCCTCATGTGACCGATCGCCACCGACCATGCATCTACCGATAGCTCGG
CGCATCCGTGGCTGGCCGTTAGATCGAGCATGCCTGCGGCTCAACTACTAGCCCCTCCTG
CTGAACAGAACTGGAGTATTTTATATTTTCAGAGAACAATTAAGTGATATATAACTAGCT
AGCAAACTAGTACTACTACTAGGAAGCGATATATCTGTGCCTTCTTGTAAGTTGATATAA
TTTGCATCGTGATGACTGGTTTGGTTAGTAGTAAATCCAAATTAAGTTTGGATGGCGAGA
GGTTTGCGAAGTTGCAGATCGATCGATTCATGCATGTCTGGAGACATGATCGATCAGTGC
TTTTAATTATAAGAGGACAGTAGAGTGTACTGCTAGCTAGTCTAGTGAGAGCTTCATGTT
TCTGTACTTTGAAAGGCTAATGCGTGTTGTTTAATGCATGGATGCTTTATTAATTTG

CDS

315 bp

>Os04t0641700-00 Similar to H0423H10.4 protein.
ATGTCGAGCAGCCGGAGGTCGCGCTCACGGCGAGCCGGGAGCTCGGTGCCGTCGTCGTCG
TCGTCGTCGAGGACGTCGATCTCGGAGGACCAGATCGCCGAGCTTCTCTCCAAGCTTCAG
GCCCTGCTCCCGGAGTCTCAGGCTCGCAATGGCGCCCATAGGGGCTCGGCGGCGAGGGTT
TTGCAGGAGACGTGCAGCTACATCAGGAGCCTGCACCAGGAGGTGGACAACCTCAGCGAG
ACGCTCGCTCAGCTGCTCGCCTCCCCCGACGTCACCAGCGACCAGGCGGCCGTCATCAGG
AGCCTCCTCATGTGA

Protein

105 aa

>Os04t0641700-00 Similar to H0423H10.4 protein.
MSSSRRSRSRRAGSSVPSSSSSSRTSISEDQIAELLSKLQALLPESQARNGAHRGSAARV
LQETCSYIRSLHQEVDNLSETLAQLLASPDVTSDQAAVIRSLLM*

5'UTR

chr04:32658176..32658183 (- strand) : 8 bp

CDS

chr04:32658014..32658175 (- strand) : 162 bp

chr04:32657761..32657913 (- strand) : 153 bp

3'UTR

chr04:32657307..32657760 (- strand) : 454 bp

FASTA

>Os04t0641700-00 class=Sequence position=chr04:32657307..32658183 (- strand)
TTGCAACCAT GTCGAGCAGC CGGAGGTCGC GCTCACGGCG AGCCGGGAGC TCGGTGCCGT CGTCGTCGTC GTCGTCGAGG
ACGTCGATCT CGGAGGACCA GATCGCCGAG CTTCTCTCCA AGCTTCAGGC CCTGCTCCCG GAGTCTCAGG CTCGCAATGG
CGCCCATAGG GTAAGCATAG CATCCTTTCC ATGTCGAACA CAACCAGAGA GAGAGCCCCC ATGAGTGAAG TAGCTAGTGA
GCTCACAGCC GCGTGTGCGT ATGAATGCAG GGCTCGGCGG CGAGGGTTTT GCAGGAGACG TGCAGCTACA TCAGGAGCCT
GCACCAGGAG GTGGACAACC TCAGCGAGAC GCTCGCTCAG CTGCTCGCCT CCCCCGACGT CACCAGCGAC CAGGCGGCCG
TCATCAGGAG CCTCCTCATG TGACCGATCG CCACCGACCA TGCATCTACC GATAGCTCGG CGCATCCGTG GCTGGCCGTT
AGATCGAGCA TGCCTGCGGC TCAACTACTA GCCCCTCCTG CTGAACAGAA CTGGAGTATT TTATATTTTC AGAGAACAAT
TAAGTGATAT ATAACTAGCT AGCAAACTAG TACTACTACT AGGAAGCGAT ATATCTGTGC CTTCTTGTAA GTTGATATAA
TTTGCATCGT GATGACTGGT TTGGTTAGTA GTAAATCCAA ATTAAGTTTG GATGGCGAGA GGTTTGCGAA GTTGCAGATC
GATCGATTCA TGCATGTCTG GAGACATGAT CGATCAGTGC TTTTAATTAT AAGAGGACAG TAGAGTGTAC TGCTAGCTAG
TCTAGTGAGA GCTTCATGTT TCTGTACTTT GAAAGGCTAA TGCGTGTTGT TTAATGCATG GATGCTTTAT TAATTTG

Locus: Os04g0641700

Loading...

Locus: Os04g0641700

Loading...