Os04t0645100-01

Locus

Os04g0645100

Description

Tetratricopeptide repeat (TPR) domain containing protein, Grain size and starch quality

RAP-DB Gene Symbol Synonym(s)

FLO2, flo2, flo3(t)

RAP-DB Gene Name Synonym(s)

FLOURY ENDOSPERM 2, floury endosperm2, floury endosperm 2, floury endosperm-2, Floury 2

CGSNL Gene Symbol

FLO2

CGSNL Gene Name

FLOURY ENDOSPERM 2

Oryzabase Gene Symbol Synonym(s)

flo2, flo3(t), Osflo2, Osflo3(t), Osflo-2, flo-2

Oryzabase Gene Name Synonym(s)

floury endosperm2, floury endosperm 2, floury endosperm-2, Floury 2

Transcript Evidence

AL606445

CAE03171

Protein Evidence

Q7XQE6 (UniProt)

Literature

PMID: 20889913

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

November 9, 2010

Gene Ontology (GO)

Molecular Function: binding (GO:0005488)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Tetratricopeptide-like helical (IPR011990)

Tetratricopeptide repeat-containing domain (IPR013026)

Tetratricopeptide repeat (IPR019734)

GSKIP/TIF31 domain (IPR023231)

Full-length cDNA

J013122D02 (Online Clone Ordering)

J023091D11 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0645100-01)

RiceXPro (AK100454)

Others

Oryzabase (629)

Transcript

5398 bp

>Os04t0645100-01 Tetratricopeptide repeat (TPR) domain containing protein, Grain size and starch quality
ATTTGTGGCTGTTGGGTTTGGAGCTTCAGGCGCAATGGCCCCCAAGGGCGCCGGCCGTGG
CAAGGGCAGGGGCGGCGGCGGCGGCGGCAAAGGCGACAAGAGGAAGAAGGAAGAGAAAGT
TGTGCCGAGTGCCATAGACGTCACGGTTGTCACTCCCTATGAATCCCAGGTTACACTCAA
GGGGATATCTACGGACCGTGTTCTGGACGTGAGGAAGCTGCTGGGCTCGAATGTGGAGAC
GTGCCACCTGACAAACTACTCGCTCTCGCACGTGACGCGAGGGCAGCGGCTGGAGGACGG
CGTGGAAATCGTGTCGCTGAAACCATGCTCTCTCACCATCGTGGAAGAGGAGTACGCGAC
GGAGGCGGCGGCGGCGGCGCAAGTCCGGCGGCTGCTGGACATCGTCGCCTGCACCACCGC
GTTCGTGAACAAGCCCCGCGACGGCGCCAAGCACAAGTCGTCCAAGCACGCGCGCCCGGC
GACGCCGCCGTCACCGCCCGCGCTCGCCGCCTCCCCCGACGCCCATGGCGCCGGCGCCGC
CCAGGCGCCGCCGATATCGGAGGCGCACGACATGGCGGCCATCCGTCCGCCGCCCAGGCT
GGGCGAGTTCTACGACTTCCTCTCCTTCGCCCACCTCACCCCGCCCGTCCACTTTATCAG
GAGGAAGGAGAGCAATGGCGCTTCTCAGGAAGGCGACTACTTCGAAATCGAGGTGAAAGT
TTGCAATGGGAAGCTCCTGCACATCGTTGCTTCCGTCAAGGGCTTCTATTCGGCAGGGAA
GCCGCACACCGTGAGCCACTCCTTGGTGGATCTGTTGCAACAGCTCAGCAGTGCATTTGC
CAATGCATATGATGCACTGATGAAAGCTTTTCTGGATCACAACAAGTTTGGGAATCTACC
ATACGGATTTCGTGCAAACACATGGCTTATTCCTCCTATATACTTGGATTCTGCTACAAA
GTGCCCAGCATTACCAGTTGAGGATGAGAATTGGGGTGGAAACGGGGGTGGCAATGGGCG
AGATGGAAAGTATGACAGAAGACGATGGGCAAAAGAATTTTCTACTTTGGCTAGAATGCC
ATGCAAAACTGAGGAAGGGAGGGTGATCAGAGACCGGAAGGCTTTTCTTTTACACAATCT
CTTTGTAGATACAGCAATTTTTAGAGCTGCATCAACAATACAGAGACTCATTGATCTGTC
TGGGAACTCAACTAGTCAACAAGCTGGCCTAGATGGTTCTTTAGCAATCGAGGAACGTGT
TGGTGACTTGCTTATAACTGTAAAGAGGGATCAGGCTGATGCTAGTTTAAAGCTGGAGGA
TAAAGTTGATGGAGTTGCACTCTATCAAACCGGTTCTATGGATATATCACAAAGAAATCT
TCTAAAAGGTTTAACTTCTGATGAAAGTGTCGTTGTTAAGGACACCTCAATACTCGGAGT
GGTTATTGTTAAACATTGTGGATATACAGCAACAGTGAAGGTTTCAGGGCGCACAAAGGA
CGGAAATGGTGGCAAACAAACCAGTGATATCTGTGATCATCTCGATGGAATTTCGAATGT
TGATGTAGATGATTTGCCAGATGGAGGTTCTAATGCCTTGAACATTAACAGTCTAAGAAT
ATCACTGCCAAAAATTGTCAACTCAGACATCGCTAGTACTCAGTGTCCTACTCCGCAGTC
TCATGTTGATAATCATGCAAGGAAACTAGTGCGCAAAATACTTGAAGATAGCTTGATGAA
GCTGGAGAACATGCCTGCCAATAATCCTAGAACCATCAGATGGGAACTTGGGTCATCCTG
GCTGCAAAACTTGCAGAAAAAGGATTCGCCGGCATCTGAGGACAAGAAAAATGCAGGACA
TGTTGAAAAAGAGACAACTATCAAAGGTCTTGGTAAGCACTTTGAACAGCTAAAGAAAAT
TAAAAAGAAAGAATGCCATGTTGAAGGTGCTATGTCTGAGAAGGAAGACTCTGACAGTAA
CTGCTCTGTCATAAATGGCATGGAAGAATCTGAAAACACCAAGGAGACTGATATTAGCAA
GCTGATGTCAGAGGATGATTTCTGTCGCCTTAAGGATCTGGGAGCTGGACTTCATCAAAA
GTCCCTTGAAGAGCTCACTATGATGGCCCATAAATTCTATGATGATACTGCGCTTCCAAA
GCTGGTGGCTGATTTTGCTTCCCTTGAACTTTCTCCTGTGGATGGAAGAACCATGACCGA
TTTCATGCACACAAGGGGTCTTAATATGTGCTCCTTAGGCCGTGTGGTAGAGCTCGCGGA
GAAGCTTCCACATATCCAGTCAATTTGCATCCATGAAATGGTCATTAGGTCCTTTAAGCA
CATTGTTCGAGCTGTTATTGCAGCTGTTGATGACATGCAAAATATGTCTGCAGCTATTGC
TGAGACTTTAAACATTTTACTTGGATGCCCAAGACTTGAAAGTGGCACTGAAACAGATGC
ACATAGTGAACATAATTTGAGATTTAGATGGGTAGAGAGGTTCCTTTCTAAAAGGTACAA
TTGGAAATTGAAAGATGAATTTGCACACTTGCGGAAATTTATCATTCTGAGAGGTCTTTG
CAGTAAGGTTGGACTTGAGTTGGTTGCGAGAGATTATGATATGAATAGCCCAAATCCATT
TGACAAATCTGACATAGTTAACATTATTCCTGTATGCAAGCATGTGGTGTACTCTTCTAT
TGATGGTCGAAACTTATTAGAATCATCAAAGATGGCTTTGGATAAAGGAAAACTTGATGA
TGCCGTCAACTTCGGAACAAAGGCGTTGTCCAAAATTGTAGCAGTTTGTGGTCCATACCA
TCGGCTGACTGCTAATGCGTACAGTCTTCTTGCTGTAGTTCTTTACCATACTGGAGATTT
TAATCAGGCAACTATATATCAGCAGAAGGCACTTGATATCAATGAAAGAGAGCTAGGTCT
TGACCACCCAGAAACTATGAAGAGTTACGGGGATTTATCTGTCTTCTACTACCGTCTCCA
GCACATCGAAATGGCTCTAAAGTATGTCAACCGTGCACTATATCTACTCCAATTTTCTTG
TGGGCTTTCACATCCAAATTCAGCTGCCACATACATAAATGTGGCTATGATGGAAGAAGG
TATGGGAAATGTTCATGTCGCTCTCAGGTACTTGCATGAAGCACTGAAGTGCAACAAGAG
ACTGCTAGGAGCTGATCACATTCAGACTGCTGCGAGCTATCATGCCATAGCCATAGCCCT
CTCAATGATGGATGCATACTCCTTGAGTGTTCAGCATGAACAGACCACCTTACAGATACT
TCAGGAGAAACTAGGACAAGATGACCTTCGAACTCAGGATGCTGCTGCATGGCTTGAGTA
TTTTGAGTCAAAAGCATTAGAACAACAAGAGGCCGCCCGAAGGGGCATCCCAAAACCTGA
CTCATCTATTGCAAGCAAAGGACATCTTAGTGTATCAGATCTACTTGACTACATAAGCCC
GGATCAGGAAAGAAAAGAGAGGGATACACAAAGAAAGGGCAGGCGTGCAAAGAATAATAT
CAGAGCCCATCAAGGTGAATTAGTTGAAGAAAAGGAGAGCTTTGAGCACGACATAGGATC
TCCTCATGAAGCAAACAAAGAGGAGTTTCAACAAGTAAAATCGAAGGCACACCCTCCAGC
AATATCAGAAGAAAATTATGCTATCCATGATGAGCTGAAGCAAGTTGATCCTTTATCACC
TGAAGAATATTCTGATGAAGGGTGGCAAGCAGCTAATTTGCGTGGACGATCTGCAAATGT
ACGGAAGAAAAGCAGTCGCAGAAGGCCCGCTCTCACTAAATTAATGGTTGATCGCTTGGA
AGATGGCCGCACAGGTTCTGCTTATAGGGCTGGTGTACAACAACACATGAAAGGAGATAA
AGAAGATGTTATAAACTCTTCTAGCCAGCTCTCCTTTGGCAGCTTTCTAAAAACTGACAA
GGTGAATGGGAATTCCAGCAATATTGAAAATAAGGTTTTCAATGCTATATCTAAACCAGA
ACGAGGCATAAAGCTTTCAGGAATTAACAGACCTGCTACTATAGCTTCCAAGTTGGTATC
ATACAAAGATGTAGCAGTGTCACCCCCTGGCACAGTCTTGAAACCGATTTTGGAGCAGAA
GGAAGCAAAGGAGAAGGATAATGCACAAAATACTGATCTAATAGTGTCATCTGAGGAGGA
AGATAAGAAGTTAACAGATGAAGATGAAGAAAAGGAAAAGCCAAGTCATGACAGCAGCAA
AGAGGTTCTTTCAAGTGAACCAGAGGAAATCGGCAATGATGAAAAAGCTCCGGACAGCAA
CAGTGATGAAAGCCCAACTGAATCTAAGAAAAAAGGTGGAAGCAAGCTTTCAGCTTCAGC
GCCTCCATTCAATCCTGGATCACTCTTATCGATGTCGCACCCTTACAGTACAGTGGCAAT
ATATGATGCTAGCGTCGTTCTTCAGCCAATACCAAGTCAACCAATGGAGATTCTCCCTCA
CGCCATTGATACTAGGGTACCCCGTGGTCCTCGGTCCACATTGTACTACCGTACTGGGCA
TACCTTCCAAAGAAAACAGGGTTACGCACACAGCCAGAGCACCATTCTGAGGGGTAGCAA
CTCCCCCCCAACCATGAATCCTCATGCTGCCGAGTTTGTGCCTGGAAAAACTTCGCAACA
ACCTGATGTGGCTAACAGAGAGCCTAGTGCAGATGTTTCTGTAACTGATTCAGCAGATCA
ACTGTTGGCACCACAGACATCAGATGAAGTAAAGGCTGGTATGCCTGCAGCAGAACAAGC
AATTCAAGGTGAGAGCACCAGCCCATGCAAAGGAAAGGAAAACAGAGCGAAAGATGCCTT
GAGAAACTCATGCAAAACAGAGCTGGCAAGGCAGATTTTGTTCAGTTTCATCGTCAAGTC
AGTACATGATAGCTTAGGTTCCACTGGAGCTGAATCGGACAGAAAACCAAGTGGACCAGA
CGAATCTGGTAATGCACAGAGCAGCAACAACATAAACAAGAGTCCGTCAGGTCGCAAAGA
GCTTGACAAACAGCAGAAGGCCACCGTGGTACCTAAGAGTGAGAAGGATACAGAAGGATT
TACAGTAGTTTCAAAACGTAGAAGAAGCAAGCAGCACTTTGTGCATCCCATACATGGTCT
CTATTCCCAGCAGTCAATTTGCACTTCTGTCAGCTAAAGGTCCCGGTAGATCTCTTTTTG
GGAGTCGCCATATTTTGGAAGAAAGGTATCGCTTAATTACTTAGCTTAGACGCTTGGTAG
CAAAAGTCTTACCCTATCCAGATGATCGAGAGCATGTAGTGAAACTGTACAAAGCTTTCC
GCAATGTCTTTTGTGTAATAAATTTTGTAATTTTGGGGTAGCAGCCGCATCAGCGCTG

CDS

5163 bp

>Os04t0645100-01 Tetratricopeptide repeat (TPR) domain containing protein, Grain size and starch quality
ATGGCCCCCAAGGGCGCCGGCCGTGGCAAGGGCAGGGGCGGCGGCGGCGGCGGCAAAGGC
GACAAGAGGAAGAAGGAAGAGAAAGTTGTGCCGAGTGCCATAGACGTCACGGTTGTCACT
CCCTATGAATCCCAGGTTACACTCAAGGGGATATCTACGGACCGTGTTCTGGACGTGAGG
AAGCTGCTGGGCTCGAATGTGGAGACGTGCCACCTGACAAACTACTCGCTCTCGCACGTG
ACGCGAGGGCAGCGGCTGGAGGACGGCGTGGAAATCGTGTCGCTGAAACCATGCTCTCTC
ACCATCGTGGAAGAGGAGTACGCGACGGAGGCGGCGGCGGCGGCGCAAGTCCGGCGGCTG
CTGGACATCGTCGCCTGCACCACCGCGTTCGTGAACAAGCCCCGCGACGGCGCCAAGCAC
AAGTCGTCCAAGCACGCGCGCCCGGCGACGCCGCCGTCACCGCCCGCGCTCGCCGCCTCC
CCCGACGCCCATGGCGCCGGCGCCGCCCAGGCGCCGCCGATATCGGAGGCGCACGACATG
GCGGCCATCCGTCCGCCGCCCAGGCTGGGCGAGTTCTACGACTTCCTCTCCTTCGCCCAC
CTCACCCCGCCCGTCCACTTTATCAGGAGGAAGGAGAGCAATGGCGCTTCTCAGGAAGGC
GACTACTTCGAAATCGAGGTGAAAGTTTGCAATGGGAAGCTCCTGCACATCGTTGCTTCC
GTCAAGGGCTTCTATTCGGCAGGGAAGCCGCACACCGTGAGCCACTCCTTGGTGGATCTG
TTGCAACAGCTCAGCAGTGCATTTGCCAATGCATATGATGCACTGATGAAAGCTTTTCTG
GATCACAACAAGTTTGGGAATCTACCATACGGATTTCGTGCAAACACATGGCTTATTCCT
CCTATATACTTGGATTCTGCTACAAAGTGCCCAGCATTACCAGTTGAGGATGAGAATTGG
GGTGGAAACGGGGGTGGCAATGGGCGAGATGGAAAGTATGACAGAAGACGATGGGCAAAA
GAATTTTCTACTTTGGCTAGAATGCCATGCAAAACTGAGGAAGGGAGGGTGATCAGAGAC
CGGAAGGCTTTTCTTTTACACAATCTCTTTGTAGATACAGCAATTTTTAGAGCTGCATCA
ACAATACAGAGACTCATTGATCTGTCTGGGAACTCAACTAGTCAACAAGCTGGCCTAGAT
GGTTCTTTAGCAATCGAGGAACGTGTTGGTGACTTGCTTATAACTGTAAAGAGGGATCAG
GCTGATGCTAGTTTAAAGCTGGAGGATAAAGTTGATGGAGTTGCACTCTATCAAACCGGT
TCTATGGATATATCACAAAGAAATCTTCTAAAAGGTTTAACTTCTGATGAAAGTGTCGTT
GTTAAGGACACCTCAATACTCGGAGTGGTTATTGTTAAACATTGTGGATATACAGCAACA
GTGAAGGTTTCAGGGCGCACAAAGGACGGAAATGGTGGCAAACAAACCAGTGATATCTGT
GATCATCTCGATGGAATTTCGAATGTTGATGTAGATGATTTGCCAGATGGAGGTTCTAAT
GCCTTGAACATTAACAGTCTAAGAATATCACTGCCAAAAATTGTCAACTCAGACATCGCT
AGTACTCAGTGTCCTACTCCGCAGTCTCATGTTGATAATCATGCAAGGAAACTAGTGCGC
AAAATACTTGAAGATAGCTTGATGAAGCTGGAGAACATGCCTGCCAATAATCCTAGAACC
ATCAGATGGGAACTTGGGTCATCCTGGCTGCAAAACTTGCAGAAAAAGGATTCGCCGGCA
TCTGAGGACAAGAAAAATGCAGGACATGTTGAAAAAGAGACAACTATCAAAGGTCTTGGT
AAGCACTTTGAACAGCTAAAGAAAATTAAAAAGAAAGAATGCCATGTTGAAGGTGCTATG
TCTGAGAAGGAAGACTCTGACAGTAACTGCTCTGTCATAAATGGCATGGAAGAATCTGAA
AACACCAAGGAGACTGATATTAGCAAGCTGATGTCAGAGGATGATTTCTGTCGCCTTAAG
GATCTGGGAGCTGGACTTCATCAAAAGTCCCTTGAAGAGCTCACTATGATGGCCCATAAA
TTCTATGATGATACTGCGCTTCCAAAGCTGGTGGCTGATTTTGCTTCCCTTGAACTTTCT
CCTGTGGATGGAAGAACCATGACCGATTTCATGCACACAAGGGGTCTTAATATGTGCTCC
TTAGGCCGTGTGGTAGAGCTCGCGGAGAAGCTTCCACATATCCAGTCAATTTGCATCCAT
GAAATGGTCATTAGGTCCTTTAAGCACATTGTTCGAGCTGTTATTGCAGCTGTTGATGAC
ATGCAAAATATGTCTGCAGCTATTGCTGAGACTTTAAACATTTTACTTGGATGCCCAAGA
CTTGAAAGTGGCACTGAAACAGATGCACATAGTGAACATAATTTGAGATTTAGATGGGTA
GAGAGGTTCCTTTCTAAAAGGTACAATTGGAAATTGAAAGATGAATTTGCACACTTGCGG
AAATTTATCATTCTGAGAGGTCTTTGCAGTAAGGTTGGACTTGAGTTGGTTGCGAGAGAT
TATGATATGAATAGCCCAAATCCATTTGACAAATCTGACATAGTTAACATTATTCCTGTA
TGCAAGCATGTGGTGTACTCTTCTATTGATGGTCGAAACTTATTAGAATCATCAAAGATG
GCTTTGGATAAAGGAAAACTTGATGATGCCGTCAACTTCGGAACAAAGGCGTTGTCCAAA
ATTGTAGCAGTTTGTGGTCCATACCATCGGCTGACTGCTAATGCGTACAGTCTTCTTGCT
GTAGTTCTTTACCATACTGGAGATTTTAATCAGGCAACTATATATCAGCAGAAGGCACTT
GATATCAATGAAAGAGAGCTAGGTCTTGACCACCCAGAAACTATGAAGAGTTACGGGGAT
TTATCTGTCTTCTACTACCGTCTCCAGCACATCGAAATGGCTCTAAAGTATGTCAACCGT
GCACTATATCTACTCCAATTTTCTTGTGGGCTTTCACATCCAAATTCAGCTGCCACATAC
ATAAATGTGGCTATGATGGAAGAAGGTATGGGAAATGTTCATGTCGCTCTCAGGTACTTG
CATGAAGCACTGAAGTGCAACAAGAGACTGCTAGGAGCTGATCACATTCAGACTGCTGCG
AGCTATCATGCCATAGCCATAGCCCTCTCAATGATGGATGCATACTCCTTGAGTGTTCAG
CATGAACAGACCACCTTACAGATACTTCAGGAGAAACTAGGACAAGATGACCTTCGAACT
CAGGATGCTGCTGCATGGCTTGAGTATTTTGAGTCAAAAGCATTAGAACAACAAGAGGCC
GCCCGAAGGGGCATCCCAAAACCTGACTCATCTATTGCAAGCAAAGGACATCTTAGTGTA
TCAGATCTACTTGACTACATAAGCCCGGATCAGGAAAGAAAAGAGAGGGATACACAAAGA
AAGGGCAGGCGTGCAAAGAATAATATCAGAGCCCATCAAGGTGAATTAGTTGAAGAAAAG
GAGAGCTTTGAGCACGACATAGGATCTCCTCATGAAGCAAACAAAGAGGAGTTTCAACAA
GTAAAATCGAAGGCACACCCTCCAGCAATATCAGAAGAAAATTATGCTATCCATGATGAG
CTGAAGCAAGTTGATCCTTTATCACCTGAAGAATATTCTGATGAAGGGTGGCAAGCAGCT
AATTTGCGTGGACGATCTGCAAATGTACGGAAGAAAAGCAGTCGCAGAAGGCCCGCTCTC
ACTAAATTAATGGTTGATCGCTTGGAAGATGGCCGCACAGGTTCTGCTTATAGGGCTGGT
GTACAACAACACATGAAAGGAGATAAAGAAGATGTTATAAACTCTTCTAGCCAGCTCTCC
TTTGGCAGCTTTCTAAAAACTGACAAGGTGAATGGGAATTCCAGCAATATTGAAAATAAG
GTTTTCAATGCTATATCTAAACCAGAACGAGGCATAAAGCTTTCAGGAATTAACAGACCT
GCTACTATAGCTTCCAAGTTGGTATCATACAAAGATGTAGCAGTGTCACCCCCTGGCACA
GTCTTGAAACCGATTTTGGAGCAGAAGGAAGCAAAGGAGAAGGATAATGCACAAAATACT
GATCTAATAGTGTCATCTGAGGAGGAAGATAAGAAGTTAACAGATGAAGATGAAGAAAAG
GAAAAGCCAAGTCATGACAGCAGCAAAGAGGTTCTTTCAAGTGAACCAGAGGAAATCGGC
AATGATGAAAAAGCTCCGGACAGCAACAGTGATGAAAGCCCAACTGAATCTAAGAAAAAA
GGTGGAAGCAAGCTTTCAGCTTCAGCGCCTCCATTCAATCCTGGATCACTCTTATCGATG
TCGCACCCTTACAGTACAGTGGCAATATATGATGCTAGCGTCGTTCTTCAGCCAATACCA
AGTCAACCAATGGAGATTCTCCCTCACGCCATTGATACTAGGGTACCCCGTGGTCCTCGG
TCCACATTGTACTACCGTACTGGGCATACCTTCCAAAGAAAACAGGGTTACGCACACAGC
CAGAGCACCATTCTGAGGGGTAGCAACTCCCCCCCAACCATGAATCCTCATGCTGCCGAG
TTTGTGCCTGGAAAAACTTCGCAACAACCTGATGTGGCTAACAGAGAGCCTAGTGCAGAT
GTTTCTGTAACTGATTCAGCAGATCAACTGTTGGCACCACAGACATCAGATGAAGTAAAG
GCTGGTATGCCTGCAGCAGAACAAGCAATTCAAGGTGAGAGCACCAGCCCATGCAAAGGA
AAGGAAAACAGAGCGAAAGATGCCTTGAGAAACTCATGCAAAACAGAGCTGGCAAGGCAG
ATTTTGTTCAGTTTCATCGTCAAGTCAGTACATGATAGCTTAGGTTCCACTGGAGCTGAA
TCGGACAGAAAACCAAGTGGACCAGACGAATCTGGTAATGCACAGAGCAGCAACAACATA
AACAAGAGTCCGTCAGGTCGCAAAGAGCTTGACAAACAGCAGAAGGCCACCGTGGTACCT
AAGAGTGAGAAGGATACAGAAGGATTTACAGTAGTTTCAAAACGTAGAAGAAGCAAGCAG
CACTTTGTGCATCCCATACATGGTCTCTATTCCCAGCAGTCAATTTGCACTTCTGTCAGC
TAA

Protein

1721 aa

>Os04t0645100-01 Tetratricopeptide repeat (TPR) domain containing protein, Grain size and starch quality
MAPKGAGRGKGRGGGGGGKGDKRKKEEKVVPSAIDVTVVTPYESQVTLKGISTDRVLDVR
KLLGSNVETCHLTNYSLSHVTRGQRLEDGVEIVSLKPCSLTIVEEEYATEAAAAAQVRRL
LDIVACTTAFVNKPRDGAKHKSSKHARPATPPSPPALAASPDAHGAGAAQAPPISEAHDM
AAIRPPPRLGEFYDFLSFAHLTPPVHFIRRKESNGASQEGDYFEIEVKVCNGKLLHIVAS
VKGFYSAGKPHTVSHSLVDLLQQLSSAFANAYDALMKAFLDHNKFGNLPYGFRANTWLIP
PIYLDSATKCPALPVEDENWGGNGGGNGRDGKYDRRRWAKEFSTLARMPCKTEEGRVIRD
RKAFLLHNLFVDTAIFRAASTIQRLIDLSGNSTSQQAGLDGSLAIEERVGDLLITVKRDQ
ADASLKLEDKVDGVALYQTGSMDISQRNLLKGLTSDESVVVKDTSILGVVIVKHCGYTAT
VKVSGRTKDGNGGKQTSDICDHLDGISNVDVDDLPDGGSNALNINSLRISLPKIVNSDIA
STQCPTPQSHVDNHARKLVRKILEDSLMKLENMPANNPRTIRWELGSSWLQNLQKKDSPA
SEDKKNAGHVEKETTIKGLGKHFEQLKKIKKKECHVEGAMSEKEDSDSNCSVINGMEESE
NTKETDISKLMSEDDFCRLKDLGAGLHQKSLEELTMMAHKFYDDTALPKLVADFASLELS
PVDGRTMTDFMHTRGLNMCSLGRVVELAEKLPHIQSICIHEMVIRSFKHIVRAVIAAVDD
MQNMSAAIAETLNILLGCPRLESGTETDAHSEHNLRFRWVERFLSKRYNWKLKDEFAHLR
KFIILRGLCSKVGLELVARDYDMNSPNPFDKSDIVNIIPVCKHVVYSSIDGRNLLESSKM
ALDKGKLDDAVNFGTKALSKIVAVCGPYHRLTANAYSLLAVVLYHTGDFNQATIYQQKAL
DINERELGLDHPETMKSYGDLSVFYYRLQHIEMALKYVNRALYLLQFSCGLSHPNSAATY
INVAMMEEGMGNVHVALRYLHEALKCNKRLLGADHIQTAASYHAIAIALSMMDAYSLSVQ
HEQTTLQILQEKLGQDDLRTQDAAAWLEYFESKALEQQEAARRGIPKPDSSIASKGHLSV
SDLLDYISPDQERKERDTQRKGRRAKNNIRAHQGELVEEKESFEHDIGSPHEANKEEFQQ
VKSKAHPPAISEENYAIHDELKQVDPLSPEEYSDEGWQAANLRGRSANVRKKSSRRRPAL
TKLMVDRLEDGRTGSAYRAGVQQHMKGDKEDVINSSSQLSFGSFLKTDKVNGNSSNIENK
VFNAISKPERGIKLSGINRPATIASKLVSYKDVAVSPPGTVLKPILEQKEAKEKDNAQNT
DLIVSSEEEDKKLTDEDEEKEKPSHDSSKEVLSSEPEEIGNDEKAPDSNSDESPTESKKK
GGSKLSASAPPFNPGSLLSMSHPYSTVAIYDASVVLQPIPSQPMEILPHAIDTRVPRGPR
STLYYRTGHTFQRKQGYAHSQSTILRGSNSPPTMNPHAAEFVPGKTSQQPDVANREPSAD
VSVTDSADQLLAPQTSDEVKAGMPAAEQAIQGESTSPCKGKENRAKDALRNSCKTELARQ
ILFSFIVKSVHDSLGSTGAESDRKPSGPDESGNAQSSNNINKSPSGRKELDKQQKATVVP
KSEKDTEGFTVVSKRRRSKQHFVHPIHGLYSQQSICTSVS*

5'UTR

chr04:32835280..32835313 (+ strand) : 34 bp

CDS

chr04:32835314..32835398 (+ strand) : 85 bp

chr04:32836039..32836100 (+ strand) : 62 bp

chr04:32836393..32836485 (+ strand) : 93 bp

chr04:32836781..32836853 (+ strand) : 73 bp

chr04:32839678..32839983 (+ strand) : 306 bp

chr04:32840069..32840127 (+ strand) : 59 bp

chr04:32840240..32840371 (+ strand) : 132 bp

chr04:32840506..32840547 (+ strand) : 42 bp

chr04:32840652..32841185 (+ strand) : 534 bp

chr04:32841281..32841471 (+ strand) : 191 bp

chr04:32841630..32842119 (+ strand) : 490 bp

chr04:32842365..32842427 (+ strand) : 63 bp

chr04:32842796..32842897 (+ strand) : 102 bp

chr04:32842987..32843307 (+ strand) : 321 bp

chr04:32843386..32843478 (+ strand) : 93 bp

chr04:32843576..32843677 (+ strand) : 102 bp

chr04:32843810..32843914 (+ strand) : 105 bp

chr04:32844025..32844158 (+ strand) : 134 bp

chr04:32844521..32844704 (+ strand) : 184 bp

chr04:32845318..32845449 (+ strand) : 132 bp

chr04:32845539..32845651 (+ strand) : 113 bp

chr04:32845720..32845801 (+ strand) : 82 bp

chr04:32846420..32848084 (+ strand) : 1665 bp

3'UTR

chr04:32848085..32848285 (+ strand) : 201 bp

FASTA

>Os04t0645100-01 class=Sequence position=chr04:32835280..32848285 (+ strand)
ATTTGTGGCT GTTGGGTTTG GAGCTTCAGG CGCAATGGCC CCCAAGGGCG CCGGCCGTGG CAAGGGCAGG GGCGGCGGCG
GCGGCGGCAA AGGCGACAAG AGGAAGAAGG AAGAGAAAGG TATTGTGTAG TACATGTTGC TGGAAGCTCG AAACCGCTTG
TGCTCTGCAA AGGCATAGAG TTCACTTCAT GGCATGAAGC TGTGTTGCTG TTGCCGTGTG AGGAGCTTTG TTCTTGCGAA
CATTGAATTC GCTGCTGCTG CTGCTGCTGC TGTAATCTGT GTGTGTTTGC TGTTCTGGCT TGGGTTCTTT TGCATGGGTA
AAGGGTGAAA AAAAGACGAT GGTCTCTCTG CTATTAGTAG CGGTAATCTT TTCTTTATTC CTTCTTTTGC TTTTGTTTCT
CTTCCTTTTT TCTTGCCTAT TCGTACTCCT GATTTCGGTG ATTATATTGC TGTTTAAGCG CTTTTTTCTT GGTGTTTAGC
TTCGTGTTCT GTGCTCATGA TTATTACTAC TAGTCTTTTG TCTTTTTTTT TTTTGCACCT TCTCTTGTTC CATTAATCCT
TTTCGTTCGC TTCCAAGCAA CATGGCCCGA TTCTTTCCTT GGTGTAACGC ACACCGTCGT GCGGTTGAGT CATGCGTTCT
GCGAGCTCTA GATGAATACT CTGTTTTCAC TTTCACCTCG ACATGATGTC GCCGTCTCCG TTTTTAAGGT TTTTTTCTGC
AGCTGTTGGT ATGATGCTGG GTTCTTCTTG TTTTTGCAGT TGTGCCGAGT GCCATAGACG TCACGGTTGT CACTCCCTAT
GAATCCCAGG TTACACTCAA GGTATGTGTG GCTGCATTAG CTGGCTGGTA CTTGCTGCAC ACATGAACAC ACAAAATACC
TGAAAGGACA ATGGACAGGA CAAGCAAAAG TGAACAGAAA CTGGTATCTT TGGGAAAAGG GGGCCTAATT CTGATAACTG
AAATGTCTGC AGCTATTTGC AATGAGCTGC AAAGCCAGTT ATTACTTACT CCACACTGCA TGCTCACAAT GAGTCCGGGA
AATTGAGCCT TTGAAATGGA ACAGTGAACC TGAGTGAAAA GATTAATCTT GTTTTTGTTC TGTGTGTGTT CAGGGGATAT
CTACGGACCG TGTTCTGGAC GTGAGGAAGC TGCTGGGCTC GAATGTGGAG ACGTGCCACC TGACAAACTA CTCGCTCTCG
CACGTGGTAA TGCTTGCTTC TTGTCTGCTA ATTCAATCAA TTGCAGTGCT TGCAGTATCT ACTGATAATT CAATTGCAGT
GCTAGTACTA GCATCTATCA TTCCACTCTT AAGTCAAAGT GTTAATTACT ACTTAATTAT CTGCCACTTC TTTGCTACTC
TTCTGGAATT CACCCGGGAT TAATTTGAGG ACAGTAACTT TTAATGTATG TGTGCTGCAA TGCTGTTAAT TCTGTAACTA
ATTCTGTATA AGCTGTGTTC GGTGAAGTCT GAATTTGTGA AGCGTGTGAT GTATGACGCA GACGCGAGGG CAGCGGCTGG
AGGACGGCGT GGAAATCGTG TCGCTGAAAC CATGCTCTCT CACCATCGTG GAAGGTACGG TCCATGGTGA AAGAATCCGC
ACGCTAGCTG CTCTTCACTT GTTCTTCCTT GCTCGTTTTG TTTCTTTCTC CTTTCTTTTT TTTTCGCTTG GCAACATGGA
ATGCTTCACA TAACATGATC GAGGTGGGGT AGCTGGCATT AGGACACATA ATTAGTTGGA TGCTTAAGTA GACGAAGCAA
CCTGACGAGA GGACAAAATT AAGCTTGAGC TTGTGGTGTA CCGTGTGGCA CAATCTGTTA GCATGACAGT GTTATGCTAC
AGTCCAAGTG TCCAAACAGT CTGCCATCAA TGATTAATCA ACCAACGGTC CGGATTTTTC CACTGAAAGC TCTAAAGTCT
GACGCTAATA TTGCTaatat tagggaagaa cctaatatca aataattaga aggggtgagg cttcaaatct aggtcgtcta
gtccaccatc ttgtggagct agctggaaga cccctaagtg tttctcaTAA GCTCTAAAGT CTGAACATGC GTTTGCCGTT
GTCCGATGGT GAAGCTAGTG GTTTTTGTTA ATGTTGACTC ACCGGTAGAT CATATCAAAC CTAACTTCAA AAATCATAAT
CTATTCAAAT TGGGACGGCA CAATGCACAT AGATGCAGCC TTGTTTGTCG ACGCACAGCA TTGAATCGAA GAGCATGGAC
CGCGCCGGCC TTTCGGCTGA ATAAACTTCA GAAGAAAAAA ACACACACAT ATGACTAGAT CACTAGATTC GCATGCTAAG
GTGCAACCTC CCACGACTCC TTGTAAATGC AGTCATGCGC CTCCATCACG CCCCAATACT GGCACACCAG TGAGTTAGAT
AGGAGCACAG AGTACAATCT AGTTCATTAT ACTTCATAAT TCTTGCCACT TAGACAGCGA GACGTGCAGG CAGGCAGCAG
CAGCAGCTTT GCATAGTGCC TCCAGTTTCA GACATTAGAA GCAGCGCATC CTGTTTCAGA CACTTAGCAT AAAATTGTTT
AGACCAAAAA AAATGTGATT TACATCTCGG GTCTCTACCG TTATCCTCAG ATACTAGCAG CAAATGGTAG CCGGTTTCAG
TGCCGCATCT GTAGCCGATG GGAGATATAG ATCGTGGCCG TGACGTCGTC GCGCGATCTG CCTCTCCGCG GTTGGTTGGG
GCGGGGCGGC TAAGGTGTTT TTTCCACACA CACACACATG TCCCGTCTCT TTCGCTGCCG ATGTCGCATT TGCCGTCGCC
GCGCGAACGT TTCACGGCGG CTTTGCCAGT TTCCGGGAGG AAGGAGGCGG CGGTTGAACC GAACCTGGAC GCCCCCGCGC
GCACGCCGGC TAATAAGCtg aggccctgtt tagatgggac taaaacactt ttaaaaacac ttttaagttc ctatcacatc
ggatgtgtac taattataaa tattaaatgt aactattaat aaaatctatc cataatcttg gactaattcg cgagacgaat
ctatttgagc ctaattaatc catgattagc ctatgtgatg ctacagtaaa tattctctaa ttatggatta attaggctta
aaaaatttgt ctcgcgaatt agctttcatt tatgtaatta gttttgtaag tagtctatat ttaatactct aaattagtgt
ctaaagatca gatatggact aaagttaagt ccctggatcc aaacacTCGC TGACGGATGC CGGTGATGTT TCGTATGGTT
TTTTTTCAAC GAAACGTGTG GCAGCGATGG TCGTGGCATG CGACCATGTG TCTGTGTCGA CGACGAAAAC GAGCATAGAA
CTTAACGATT GATTAGTGCG TAAGACTGTA CGAGGAAGGG GATGACTGAC CGATTGGTCT GACACGCGCT CGTAGTCAAA
TGCACTTGCT TTTACTGCTA CCGTAGTCCA TCATTTTAAA AAAAAAAACC TGAAATTCAA GTGCAAAGTG GCATTTGGAC
AAACTGGAAG GGCATTTTCA CTCGTTGATA GCGCTTGATT AGTTGCCTAG GCGAAGTCCG TCTTGTGCAC TTCTCTAGTG
GGTCAGAGCC TCTTGTTCTG CTTTGGGAAA TACATGCTCG TTAATTAACT GAACATAGTG CTCCACCTGC TGTCTGTCTC
ATATGGTATT TAGAACTGAA AGCTATACTA GTGTACAATT AATTACTGCA GAATTATGCG ATTTTGTAGT TGTTGTATGC
TCCAAGGTCT GAGCTAATGG CTCACCGGTT GTTGTCCTGT CCTAAACGCC GGTACGGGAC AAAAGGACGC CTCTTGGAAT
CAGCGTTGGG CGTTAGCTCA AGTGCCTAAC TTATTTTACT CGCCACTCTT CTGACGAATC GACGGGTTTG TGAATTGTGA
TTGTACATTT GTTTGTAGTA TTGGTGTTTA GGTGGTCACT GACTCATACT GGTCAGTACA GTACGTGCTA GACCTGCTAC
CGGTCGTACC GATGCCATGA GTCAAAATCA CGTTGTTGGC CATGTGTTTC TAACTCGCTG ACACCGCTGG GAACGTGATA
GAATAGCGAC ATAGCGGTGA TAGTACTTAC TACTATGACA CGAGTATCAA AACTTCAGCC ACGTTCCTGT GGATGAACAT
CAGTCTTAAG CCATTTTTTT TTTATTTTTA CATTTGAATT CGATTTATTC TATTTTGATT TGATTCGACG ACTTTTGTTC
AATATGATGC AGCAGCTGCT AAAAAAACAA AAGAAATTGC TTCGCTTATT TGTTCCAGAA TTGATGGGCC TGTTCATTTA
TAAAGGGAAG CCCAGCACTT GGCCTATTGG GCCTGAATTT TGGTAGAGCT AATCGAGCCC ATGGGCCTTT TTGTGCAGAG
GAGTACGCGA CGGAGGCGGC GGCGGCGGCG CAAGTCCGGC GGCTGCTGGA CATCGTCGCC TGCACCACCG CGTTCGTGAA
CAAGCCCCGC GACGGCGCCA AGCACAAGTC GTCCAAGCAC GCGCGCCCGG CGACGCCGCC GTCACCGCCC GCGCTCGCCG
CCTCCCCCGA CGCCCATGGC GCCGGCGCCG CCCAGGCGCC GCCGATATCG GAGGCGCACG ACATGGCGGC CATCCGTCCG
CCGCCCAGGC TGGGCGAGTT CTACGACTTC CTCTCCTTCG CCCACCTCAC CCCGCCCGTC CACTGTAAGG CCGAATGCTG
CATCGCGTTT CCCCCTTTTT GCGAGGCGTG GAACTAGGGG TTGGACTGAC GCGTGGTTGC GGTGTGCAGT TATCAGGAGG
AAGGAGAGCA ATGGCGCTTC TCAGGAAGGC GACTACTTCG AAATCGAGGT GTGATGCGAT GTCTCTCAGA ACGCTAGAGA
GTTCGTCTGA TCTGCAGTAG CCAACTCCGC GATGAGTCTA TGACTACGCA CTTCACTGAC GGGAGTTGAT GTGTGGCCAG
GTGAAAGTTT GCAATGGGAA GCTCCTGCAC ATCGTTGCTT CCGTCAAGGG CTTCTATTCG GCAGGGAAGC CGCACACCGT
GAGCCACTCC TTGGTGGATC TGTTGCAACA GCTCAGCAGT GCATTTGCCA ATGTGAGTAA CCATGAATCC TGAACATGTA
TAATGTATAA CGCGTTGCTC GATTTACTTT CTGCTCCTGT TTGTTTTTGG CTAACTATAC AGCCGACCTT ATCTGACAGT
GATGTCTTCT AATTCATTTT GCACAGGCAT ATGATGCACT GATGAAAGCT TTTCTGGATC ACAACAAGGT GGTTATAGTA
AATGCTGTTT CCTTTTTTTT TTTCCCCCTT ATACCGTAGA TTTAGTCAAG TAAAATGCTA AATTTGACAA GGATACTTCT
TTGCATCTCC AGTTTGGGAA TCTACCATAC GGATTTCGTG CAAACACATG GCTTATTCCT CCTATATACT TGGATTCTGC
TACAAAGTGC CCAGCATTAC CAGTTGAGGA TGAGAATTGG GGTGGAAACG GGGGTGGCAA TGGGCGAGAT GGAAAGTATG
ACAGAAGACG ATGGGCAAAA GAATTTTCTA CTTTGGCTAG AATGCCATGC AAAACTGAGG AAGGGAGGGT GATCAGAGAC
CGGAAGGCTT TTCTTTTACA CAATCTCTTT GTAGATACAG CAATTTTTAG AGCTGCATCA ACAATACAGA GACTCATTGA
TCTGTCTGGG AACTCAACTA GTCAACAAGC TGGCCTAGAT GGTTCTTTAG CAATCGAGGA ACGTGTTGGT GACTTGCTTA
TAACTGTAAA GAGGGATCAG GCTGATGCTA GTTTAAAGCT GGAGGATAAA GTTGATGGAG TTGCACTCTA TCAAACCGGT
TCTATGGATA TATCACAAAG AAATCTTCTA AAAGGTTTAA CTTCTGATGA AAGTGTCGTT GTTAAGGTGG TGGCATACTA
CTTTCATATC TCTTTTTTTT TCAAATTATT TTTTGTCCTT AATATTAATT ACCGATTTCC ACCAACATGA TTACCATTCA
GGACACCTCA ATACTCGGAG TGGTTATTGT TAAACATTGT GGATATACAG CAACAGTGAA GGTTTCAGGG CGCACAAAGG
ACGGAAATGG TGGCAAACAA ACCAGTGATA TCTGTGATCA TCTCGATGGA ATTTCGAATG TTGATGTAGA TGATTTGCCA
GATGGAGGTT CTAATGCCTT GAACATTAAC AGGTTTGATA TATGTTCCCA TGTAAACTTA TTCACATGCT TGCTCATCAG
TAGAGAAAAT AATGTTCACT GGTAACTAGT TTTTCTTACA TTTGGCACAC AATAATGTTC CATTAACACA ACTCTCTCTC
TCTCTCTCTC TCTGTATATG TGTGTTTCAG TCTAAGAATA TCACTGCCAA AAATTGTCAA CTCAGACATC GCTAGTACTC
AGTGTCCTAC TCCGCAGTCT CATGTTGATA ATCATGCAAG GAAACTAGTG CGCAAAATAC TTGAAGATAG CTTGATGAAG
CTGGAGAACA TGCCTGCCAA TAATCCTAGA ACCATCAGAT GGGAACTTGG GTCATCCTGG CTGCAAAACT TGCAGAAAAA
GGATTCGCCG GCATCTGAGG ACAAGAAAAA TGCAGGACAT GTTGAAAAAG AGACAACTAT CAAAGGTCTT GGTAAGCACT
TTGAACAGCT AAAGAAAATT AAAAAGAAAG AATGCCATGT TGAAGGTGCT ATGTCTGAGA AGGAAGACTC TGACAGTAAC
TGCTCTGTCA TAAATGGCAT GGAAGAATCT GAAAACACCA AGGAGACTGA TATTAGCAAG CTGATGTCAG AGGATGATTT
CTGTCGCCTT AAGGATCTGG GAGCTGGACT TCATCAAAAG GTAATTTATA GCTATACAGT TCATCAATCA ATATGGTCTG
AACAATTTAG TTTTATGTCC GGTAAGCTCA TACATGCTAT TTTGCTTGGG ATTAAAGTTC TAATCTGTTA AAATTTTCAC
CAGAAGCCTT GTGTTAAGCT GAATATGATG TAGTAGCAGA AGCGCAGCAT TGTATTTTTC CAGTAATCAG GAATATATTG
GTTATTTTGC TGTTTAATAC TTAACTTTGT TATTTCTTGA ACTAGTCCCT TGAAGAGCTC ACTATGATGG CCCATAAATT
CTATGATGAT ACTGCGCTTC CAAAGCTGGT AAGCCTTGCC TTGTTTATTT GGAGATCCTT ATGTAAATTC TCGAACATTT
TAATCGGCAC TCTCTTCTCT GAAAACAAAG TAGTCGCTTT TTGCTGGCAT TGGTATTGTT TATTGTTTAT TGTTGTAGTA
AGTAGTTTAG TTATGGTACT AATGTTCAGT TAGTTCATTT GTAATTTTGA GGAAGTAGTC AATCCACATT AACAATTCGC
ACCACAAAGT CCAAAAGAAT TACAGTTCTT GAAAATTTTT GCGTGTAAAG AAGAAAAAAA AAACAATGTT TTTTTTATGT
TGTCTTAAAC TTTCTTAATT ATTATTTGAT GCCCATAATA GATAGTTAAT TTTTTCTTGG AATAAAATAA TGACAGGTGG
CTGATTTTGC TTCCCTTGAA CTTTCTCCTG TGGATGGAAG AACCATGACC GATTTCATGC ACACAAGGGG TCTTAATATG
TGCTCCTTAG GCCGTGTGGT GAGTTTAAAT TTATTCTGAA TTACTTTTGC TTCTATGGTT GGATGGAATT TCCAGAATAA
CCTTTTTTTT ATATATAAAT TAAACAGGTA GAGCTCGCGG AGAAGCTTCC ACATATCCAG TCAATTTGCA TCCATGAAAT
GGTCATTAGG TCCTTTAAGC ACATTGTTCG AGCTGTTATT GCAGCTGTTG ATGACATGCA AAATATGTCT GCAGCTATTG
CTGAGACTTT AAACATTTTA CTTGGATGCC CAAGACTTGA AAGTGGCACT GAAACAGATG CACATAGTGA ACATAATTTG
AGATTTAGAT GGGTAGAGAG GTTCCTTTCT AAAAGGTACA ATTGGAAATT GAAAGATGAA TTTGCACACT TGCGGAAATT
TATCATTCTG AGAGGTCTTT GCAGTAAGGT ACAATCCAAA GTGTGTTCCA AAACATTCAT AGAGTACAGT TTCTGAACAT
GCATAATTAA TATGTTTATT TCTCAGGTTG GACTTGAGTT GGTTGCGAGA GATTATGATA TGAATAGCCC AAATCCATTT
GACAAATCTG ACATAGTTAA CATTATTCCT GTATGCAAGG TAGGACACTA TCAGAAAACT TACCACTGTA CTTTCCCCAC
CACCTGAATT AATAATTATA TTGATTTGAT CTGCTTTGGC CTTGCGCTTC TTACAGCATG TGGTGTACTC TTCTATTGAT
GGTCGAAACT TATTAGAATC ATCAAAGATG GCTTTGGATA AAGGAAAACT TGATGATGCC GTCAACTTCG GAACAAAGGT
ATGCAATAAT CAGTTCTTTT TTCTGTACGT TGTTTAACAG CTATGCTAAA ATATTTCTCT TCCTGCTTTG GTTGGGTGAA
GTTACCATTC TAAATTCTTT CATTAACTAT TTTTTTTTCT TTTCTTGAAG GCGTTGTCCA AAATTGTAGC AGTTTGTGGT
CCATACCATC GGCTGACTGC TAATGCGTAC AGTCTTCTTG CTGTAGTTCT TTACCATACT GGAGATTTTA ATCAGGTATT
TCAATGAATT TGGTGGGCTG TATTCTATCT GCTGCATAGT GATGTGTTTT TGGCACAATG TTTGGCAACT GCATTTTTCA
CTAGACTTCT GTTCTTTCTC TGTAGGCAAC TATATATCAG CAGAAGGCAC TTGATATCAA TGAAAGAGAG CTAGGTCTTG
ACCACCCAGA AACTATGAAG AGTTACGGGG ATTTATCTGT CTTCTACTAC CGTCTCCAGC ACATCGAAAT GGCTCTAAAG
TAAGTGCTGC TATTAGGTGT TTTGTTGTGG AAACACAAAA GCTAGTTTCA TGACTTGGCT TGTAGCTGGT ATTACTATCA
TGCACAATGT CGTTACGCTG GTTCATTTCT AGCCATTACA TGCATTAAAT ATATTGCCTG TAGAATGGAT ACTACTGCAT
TTGTACGGCA CTATGGCTGT ATTAATTTGT AGACTTGAAC TGTGCATTGT TTTGCATTAT TGTCCATGAT TGTTACTTGT
GGTTTGCACG GAAACTTGCT GAAGGCACAT ATTTGCTTGA CAATATTGTC AAAACTCATC TTCCATCTTT CTTTTTTTGC
CTTTTGTTTT TTGTATCGCT AATGGTATCT TTTTCTTAAA GGTATGTCAA CCGTGCACTA TATCTACTCC AATTTTCTTG
TGGGCTTTCA CATCCAAATT CAGCTGCCAC ATACATAAAT GTGGCTATGA TGGAAGAAGG TATGGGAAAT GTTCATGTCG
CTCTCAGGTA CTTGCATGAA GCACTGAAGT GCAACAAGAG ACTGCTAGGA GCTGATCACA TTCAGGTAAA CAAAACTACA
TATTTTTCTC TTACCGTGCT TTCACAGCTT TATCTGTTTT CCTGGAAACA ATAATCTAAT TGTTTTTTTT GTTGGACTTG
ATTGATGTGC ATTAAAGTAC AGTCTTGTAA GATCAATTCC ATGCGTACTA TCTCTTGCAC CAATATTTCT GCAGAAGTAC
TGGCATTGGC GGCATACTTG TCTTATTAAG GATATTAGAC ATATACACCT CTGATACAGT AGAAATGTCC CATAAGTATC
TATGTCTGAA GCAAACTTTT TGATTTAGCT CTAATATCCC TAGATATTCT CCATTGCTGT CCCTCAAAGG CCATGAGCAA
TTGTTTAAGT TTCTTTCAAT TTCCTATCCA ACTTGTTTAT TGCATATCCA ATTTCAAAAC TAGCATCTTG TTTCAGTAGT
ACCCGCGCCA CCATGACTTG TATCTTTTAA GGAAAGGTTT ATTTTGATGT CTAGACCCAC AGAAACAGTC TTTTCTGTAT
ATTTCAATCC GTTTGACATA ATGCATGTAA CTACGGACAA CTTCAATGGC GTATTTGTTA TGCATATGAT CCCGTGATTC
AGTTAACATG AATTTTCATG CATTTCTTTG AACAACAGAC TGCTGCGAGC TATCATGCCA TAGCCATAGC CCTCTCAATG
ATGGATGCAT ACTCCTTGAG TGTTCAGCAT GAACAGACCA CCTTACAGAT ACTTCAGGAG AAACTAGGAC AAGATGACCT
TCGAACTCAG GTTTTTTTTC CCTTCAAAAT ATGCAATGAC GAGTCCAAAT ACTGCTATGT TCTCTTGGAC TATTAGACAT
GATAATTTTC CTGCTGCAGG ATGCTGCTGC ATGGCTTGAG TATTTTGAGT CAAAAGCATT AGAACAACAA GAGGCCGCCC
GAAGGGGCAT CCCAAAACCT GACTCATCTA TTGCAAGCAA AGGACATCTT AGGTATGAAT ACACTGTGCA TTATCAGTCG
CAAACTGTGA TGATCTGGAT TGAAACATTT ATCTTTCCAG TGTATCAGAT CTACTTGACT ACATAAGCCC GGATCAGGAA
AGAAAAGAGA GGGATACACA AAGAAAGGGC AGGCGTGCAA AGGTGATTAT AACATGCCTA CTTTTTCAAA ATTATTGTTG
TTAAAATGTA GTCAGAAGAG ATAAGTGCAC ACTGGACAGT GGAGACAATT CCATCAGTAT TCATGAAAAG TCTAGATGAG
AATAGGATTG GCACAATAAC TTCCATATAG GATGTCTGGT ATATGAACTG ATGAACATAT GCTGGCAGCA AATCAGCAAT
CCTATCCAGT TCATGAAACT AGTAAAAGGT TATGAACCAT CATCACTGAC ATAATAACCA TGACAGTTAT CCCCACCAGT
CATTGTTGGA GCATGAACTA TGAGAATTGA AAAGATATTC CCGCATCCAC AGCTAGTCCA TTGATACCAG GCATTTATCC
AGATGATTCC AGTTCAACCC ATTAACTTAG CAATGAATTG ACAACACAAT TTCTTCTTAG TTGGGAATTT AACTCCCTTT
ACATATGGAT ATTTAATCCT TTGTTTTCTA ATATGCTTCA TGAATTGGGA ATCACAATAT ACATATTTTG GAAGTCCATT
GATGTCATGG TTTCAATTGT TGCCTAAACA TTATGCAAGC TTTTATTTTA CCCTTACTAC CCTTTGCTTT CCTTTTCACC
TTGTATAGTA TTAAATGCAG AATAATATCA GAGCCCATCA AGGTGAATTA GTTGAAGAAA AGGAGAGCTT TGAGCACGAC
ATAGGATCTC CTCATGAAGC AAACAAAGAG GAGTTTCAAC AAGTAAAATC GAAGGCACAC CCTCCAGCAA TATCAGAAGA
AAATTATGCT ATCCATGATG AGCTGAAGCA AGTTGATCCT TTATCACCTG AAGAATATTC TGATGAAGGG TGGCAAGCAG
CTAATTTGCG TGGACGATCT GCAAATGTAC GGAAGAAAAG CAGTCGCAGA AGGCCCGCTC TCACTAAATT AATGGTTGAT
CGCTTGGAAG ATGGCCGCAC AGGTTCTGCT TATAGGGCTG GTGTACAACA ACACATGAAA GGAGATAAAG AAGATGTTAT
AAACTCTTCT AGCCAGCTCT CCTTTGGCAG CTTTCTAAAA ACTGACAAGG TGAATGGGAA TTCCAGCAAT ATTGAAAATA
AGGTTTTCAA TGCTATATCT AAACCAGAAC GAGGCATAAA GCTTTCAGGA ATTAACAGAC CTGCTACTAT AGCTTCCAAG
TTGGTATCAT ACAAAGATGT AGCAGTGTCA CCCCCTGGCA CAGTCTTGAA ACCGATTTTG GAGCAGAAGG AAGCAAAGGA
GAAGGATAAT GCACAAAATA CTGATCTAAT AGTGTCATCT GAGGAGGAAG ATAAGAAGTT AACAGATGAA GATGAAGAAA
AGGAAAAGCC AAGTCATGAC AGCAGCAAAG AGGTTCTTTC AAGTGAACCA GAGGAAATCG GCAATGATGA AAAAGCTCCG
GACAGCAACA GTGATGAAAG CCCAACTGAA TCTAAGAAAA AAGGTGGAAG CAAGCTTTCA GCTTCAGCGC CTCCATTCAA
TCCTGGATCA CTCTTATCGA TGTCGCACCC TTACAGTACA GTGGCAATAT ATGATGCTAG CGTCGTTCTT CAGCCAATAC
CAAGTCAACC AATGGAGATT CTCCCTCACG CCATTGATAC TAGGGTACCC CGTGGTCCTC GGTCCACATT GTACTACCGT
ACTGGGCATA CCTTCCAAAG AAAACAGGGT TACGCACACA GCCAGAGCAC CATTCTGAGG GGTAGCAACT CCCCCCCAAC
CATGAATCCT CATGCTGCCG AGTTTGTGCC TGGAAAAACT TCGCAACAAC CTGATGTGGC TAACAGAGAG CCTAGTGCAG
ATGTTTCTGT AACTGATTCA GCAGATCAAC TGTTGGCACC ACAGACATCA GATGAAGTAA AGGCTGGTAT GCCTGCAGCA
GAACAAGCAA TTCAAGGTGA GAGCACCAGC CCATGCAAAG GAAAGGAAAA CAGAGCGAAA GATGCCTTGA GAAACTCATG
CAAAACAGAG CTGGCAAGGC AGATTTTGTT CAGTTTCATC GTCAAGTCAG TACATGATAG CTTAGGTTCC ACTGGAGCTG
AATCGGACAG AAAACCAAGT GGACCAGACG AATCTGGTAA TGCACAGAGC AGCAACAACA TAAACAAGAG TCCGTCAGGT
CGCAAAGAGC TTGACAAACA GCAGAAGGCC ACCGTGGTAC CTAAGAGTGA GAAGGATACA GAAGGATTTA CAGTAGTTTC
AAAACGTAGA AGAAGCAAGC AGCACTTTGT GCATCCCATA CATGGTCTCT ATTCCCAGCA GTCAATTTGC ACTTCTGTCA
GCTAAAGGTC CCGGTAGATC TCTTTTTGGG AGTCGCCATA TTTTGGAAGA AAGGTATCGC TTAATTACTT AGCTTAGACG
CTTGGTAGCA AAAGTCTTAC CCTATCCAGA TGATCGAGAG CATGTAGTGA AACTGTACAA AGCTTTCCGC AATGTCTTTT
GTGTAATAAA TTTTGTAATT TTGGGGTAGC AGCCGCATCA GCGCTG

Locus: Os04g0645100

Loading...

Locus: Os04g0645100

Loading...