Os04t0645100-02

Locus

Os04g0645100

Description

Similar to H0811D08.1 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

FLO2

CGSNL Gene Name

FLOURY ENDOSPERM 2

Oryzabase Gene Symbol Synonym(s)

flo2, flo3(t), Osflo2, Osflo3(t), Osflo-2, flo-2

Oryzabase Gene Name Synonym(s)

floury endosperm2, floury endosperm 2, floury endosperm-2, Floury 2

Transcript Evidence

AK100454 (DDBJ, Best hit)

Protein Evidence

Q25AP6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: binding (GO:0005488)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Tetratricopeptide-like helical (IPR011990)

Tetratricopeptide repeat-containing (IPR013026)

Tetratricopeptide repeat (IPR019734)

Full-length cDNA

J023091D11 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0645100-02)

RiceXPro (AK100454)

Others

Oryzabase (629)

KEGG (Os04t0645100-02)

Transcript

2669 bp

>Os04t0645100-02 Similar to H0811D08.1 protein.
AGATGGCTTTGGATAAAGGAAAACTTGATGATGCCGTCAACTTCGGAACAAAGGCGTTGT
CCAAAATTGTAGCAGTTTGTGGTCCATACCATCGGCTGACTGCTAATGCGTACAGTCTTC
TTGCTGTAGTTCTTTACCATACTGGAGATTTTAATCAGGCAACTATATATCAGCAGAAGG
CACTTGATATCAATGAAAGAGAGCTAGGTCTTGACCACCCAGAAACTATGAAGAGTTACG
GGGATTTATCTGTCTTCTACTACCGTCTCCAGCACATCGAAATGGCTCTAAAGTATGTCA
ACCGTGCACTATATCTACTCCAATTTTCTTGTGGGCTTTCACATCCAAATTCAGCTGCCA
CATACATAAATGTGGCTATGATGGAAGAAGGTATGGGAAATGTTCATGTCGCTCTCAGGT
ACTTGCATGAAGCACTGAAGTGCAACAAGAGACTGCTAGGAGCTGATCACATTCAGACTG
CTGCGAGCTATCATGCCATAGCCATAGCCCTCTCAATGATGGATGCATACTCCTTGAGTG
TTCAGCATGAACAGACCACCTTACAGATACTTCAGGAGAAACTAGGACAAGATGACCTTC
GAACTCAGGATGCTGCTGCATGGCTTGAGTATTTTGAGTCAAAAGCATTAGAACAACAAG
AGGCCGCCCGAAGGGGCATCCCAAAACCTGACTCATCTATTGCAAGCAAAGGACATCTTA
GTGTATCAGATCTACTTGACTACATAAGCCCGGATCAGGAAAGAAAAGAGAGGGATACAC
AAAGAAAGGGCAGGCGTGCAAAGAATAATATCAGAGCCCATCAAGGTGAATTAGTTGAAG
AAAAGGAGAGCTTTGAGCACGACATAGGATCTCCTCATGAAGCAAACAAAGAGGAGTTTC
AACAAGTAAAATCGAAGGCACACCCTCCAGCAATATCAGAAGAAAATTATGCTATCCATG
ATGAGCTGAAGCAAGTTGATCCTTTATCACCTGAAGAATATTCTGATGAAGGGTGGCAAG
CAGCTAATTTGCGTGGACGATCTGCAAATGTACGGAAGAAAAGCAGTCGCAGAAGGCCCG
CTCTCACTAAATTAATGGTTGATCGCTTGGAAGATGGCCGCACAGGTTCTGCTTATAGGG
CTGGTGTACAACAACACATGAAAGGAGATAAAGAAGATGTTATAAACTCTTCTAGCCAGC
TCTCCTTTGGCAGCTTTCTAAAAACTGACAAGGTGAATGGGAATTCCAGCAATATTGAAA
ATAAGGTTTTCAATGCTATATCTAAACCAGAACGAGGCATAAAGCTTTCAGGAATTAACA
GACCTGCTACTATAGCTTCCAAGTTGGTATCATACAAAGATGTAGCAGTGTCACCCCCTG
GCACAGTCTTGAAACCGATTTTGGAGCAGAAGGAAGCAAAGGAGAAGGATAATGCACAAA
ATACTGATCTAATAGTGTCATCTGAGGAGGAAGATAAGAAGTTAACAGATGAAGATGAAG
AAAAGGAAAAGCCAAGTCATGACAGCAGCAAAGAGGTTCTTTCAAGTGAACCAGAGGAAA
TCGGCAATGATGAAAAAGCTCCGGACAGCAACAGTGATGAAAGCCCAACTGAATCTAAGA
AAAAAGGTGGAAGCAAGCTTTCAGCTTCAGCGCCTCCATTCAATCCTGGATCACTCTTAT
CGATGTCGCACCCTTACAGTACAGTGGCAATATATGATGCTAGCGTCGTTCTTCAGCCAA
TACCAAGTCAACCAATGGAGATTCTCCCTCACGCCATTGATACTAGGGTACCCCGTGGTC
CTCGGTCCACATTGTACTACCGTACTGGGCATACCTTCCAAAGAAAACAGGGTTACGCAC
ACAGCCAGAGCACCATTCTGAGGGGTAGCAACTCCCCCCCAACCATGAATCCTCATGCTG
CCGAGTTTGTGCCTGGAAAAACTTCGCAACAACCTGATGTGGCTAACAGAGAGCCTAGTG
CAGATGTTTCTGTAACTGATTCAGCAGATCAACTGTTGGCACCACAGACATCAGATGAAG
TAAAGGCTGGTATGCCTGCAGCAGAACAAGCAATTCAAGGTGAGAGCACCAGCCCATGCA
AAGGAAAGGAAAACAGAGCGAAAGATGCCTTGAGAAACTCATGCAAAACAGAGCTGGCAA
GGCAGATTTTGTTCAGTTTCATCGTCAAGTCAGTACATGATAGCTTAGGTTCCACTGGAG
CTGAATCGGACAGAAAACCAAGTGGACCAGACGAATCTGGTAATGCACAGAGCAGCAACA
ACATAAACAAGAGTCCGTCAGGTCGCAAAGAGCTTGACAAACAGCAGAAGGCCACCGTGG
TACCTAAGAGTGAGAAGGATACAGAAGGATTTACAGTAGTTTCAAAACGTAGAAGAAGCA
AGCAGCACTTTGTGCATCCCATACATGGTCTCTATTCCCAGCAGTCAATTTGCACTTCTG
TCAGCTAAAGGTCCCGGTAGATCTCTTTTTGGGAGTCGCCATATTTTGGAAGAAAGGTAT
CGCTTAATTACTTAGCTTAGACGCTTGGTAGCAAAAGTCTTACCCTATCCAGATGATCGA
GAGCATGTAGTGAAACTGTACAAAGCTTTCCGCAATGTCTTTTGTGTAATAAATTTTGTA
ATTTTGGGGTAGCAGCCGCATCAGCGCTG

CDS

2466 bp

>Os04t0645100-02 Similar to H0811D08.1 protein.
ATGGCTTTGGATAAAGGAAAACTTGATGATGCCGTCAACTTCGGAACAAAGGCGTTGTCC
AAAATTGTAGCAGTTTGTGGTCCATACCATCGGCTGACTGCTAATGCGTACAGTCTTCTT
GCTGTAGTTCTTTACCATACTGGAGATTTTAATCAGGCAACTATATATCAGCAGAAGGCA
CTTGATATCAATGAAAGAGAGCTAGGTCTTGACCACCCAGAAACTATGAAGAGTTACGGG
GATTTATCTGTCTTCTACTACCGTCTCCAGCACATCGAAATGGCTCTAAAGTATGTCAAC
CGTGCACTATATCTACTCCAATTTTCTTGTGGGCTTTCACATCCAAATTCAGCTGCCACA
TACATAAATGTGGCTATGATGGAAGAAGGTATGGGAAATGTTCATGTCGCTCTCAGGTAC
TTGCATGAAGCACTGAAGTGCAACAAGAGACTGCTAGGAGCTGATCACATTCAGACTGCT
GCGAGCTATCATGCCATAGCCATAGCCCTCTCAATGATGGATGCATACTCCTTGAGTGTT
CAGCATGAACAGACCACCTTACAGATACTTCAGGAGAAACTAGGACAAGATGACCTTCGA
ACTCAGGATGCTGCTGCATGGCTTGAGTATTTTGAGTCAAAAGCATTAGAACAACAAGAG
GCCGCCCGAAGGGGCATCCCAAAACCTGACTCATCTATTGCAAGCAAAGGACATCTTAGT
GTATCAGATCTACTTGACTACATAAGCCCGGATCAGGAAAGAAAAGAGAGGGATACACAA
AGAAAGGGCAGGCGTGCAAAGAATAATATCAGAGCCCATCAAGGTGAATTAGTTGAAGAA
AAGGAGAGCTTTGAGCACGACATAGGATCTCCTCATGAAGCAAACAAAGAGGAGTTTCAA
CAAGTAAAATCGAAGGCACACCCTCCAGCAATATCAGAAGAAAATTATGCTATCCATGAT
GAGCTGAAGCAAGTTGATCCTTTATCACCTGAAGAATATTCTGATGAAGGGTGGCAAGCA
GCTAATTTGCGTGGACGATCTGCAAATGTACGGAAGAAAAGCAGTCGCAGAAGGCCCGCT
CTCACTAAATTAATGGTTGATCGCTTGGAAGATGGCCGCACAGGTTCTGCTTATAGGGCT
GGTGTACAACAACACATGAAAGGAGATAAAGAAGATGTTATAAACTCTTCTAGCCAGCTC
TCCTTTGGCAGCTTTCTAAAAACTGACAAGGTGAATGGGAATTCCAGCAATATTGAAAAT
AAGGTTTTCAATGCTATATCTAAACCAGAACGAGGCATAAAGCTTTCAGGAATTAACAGA
CCTGCTACTATAGCTTCCAAGTTGGTATCATACAAAGATGTAGCAGTGTCACCCCCTGGC
ACAGTCTTGAAACCGATTTTGGAGCAGAAGGAAGCAAAGGAGAAGGATAATGCACAAAAT
ACTGATCTAATAGTGTCATCTGAGGAGGAAGATAAGAAGTTAACAGATGAAGATGAAGAA
AAGGAAAAGCCAAGTCATGACAGCAGCAAAGAGGTTCTTTCAAGTGAACCAGAGGAAATC
GGCAATGATGAAAAAGCTCCGGACAGCAACAGTGATGAAAGCCCAACTGAATCTAAGAAA
AAAGGTGGAAGCAAGCTTTCAGCTTCAGCGCCTCCATTCAATCCTGGATCACTCTTATCG
ATGTCGCACCCTTACAGTACAGTGGCAATATATGATGCTAGCGTCGTTCTTCAGCCAATA
CCAAGTCAACCAATGGAGATTCTCCCTCACGCCATTGATACTAGGGTACCCCGTGGTCCT
CGGTCCACATTGTACTACCGTACTGGGCATACCTTCCAAAGAAAACAGGGTTACGCACAC
AGCCAGAGCACCATTCTGAGGGGTAGCAACTCCCCCCCAACCATGAATCCTCATGCTGCC
GAGTTTGTGCCTGGAAAAACTTCGCAACAACCTGATGTGGCTAACAGAGAGCCTAGTGCA
GATGTTTCTGTAACTGATTCAGCAGATCAACTGTTGGCACCACAGACATCAGATGAAGTA
AAGGCTGGTATGCCTGCAGCAGAACAAGCAATTCAAGGTGAGAGCACCAGCCCATGCAAA
GGAAAGGAAAACAGAGCGAAAGATGCCTTGAGAAACTCATGCAAAACAGAGCTGGCAAGG
CAGATTTTGTTCAGTTTCATCGTCAAGTCAGTACATGATAGCTTAGGTTCCACTGGAGCT
GAATCGGACAGAAAACCAAGTGGACCAGACGAATCTGGTAATGCACAGAGCAGCAACAAC
ATAAACAAGAGTCCGTCAGGTCGCAAAGAGCTTGACAAACAGCAGAAGGCCACCGTGGTA
CCTAAGAGTGAGAAGGATACAGAAGGATTTACAGTAGTTTCAAAACGTAGAAGAAGCAAG
CAGCACTTTGTGCATCCCATACATGGTCTCTATTCCCAGCAGTCAATTTGCACTTCTGTC
AGCTAA

Protein

822 aa

>Os04t0645100-02 Similar to H0811D08.1 protein.
MALDKGKLDDAVNFGTKALSKIVAVCGPYHRLTANAYSLLAVVLYHTGDFNQATIYQQKA
LDINERELGLDHPETMKSYGDLSVFYYRLQHIEMALKYVNRALYLLQFSCGLSHPNSAAT
YINVAMMEEGMGNVHVALRYLHEALKCNKRLLGADHIQTAASYHAIAIALSMMDAYSLSV
QHEQTTLQILQEKLGQDDLRTQDAAAWLEYFESKALEQQEAARRGIPKPDSSIASKGHLS
VSDLLDYISPDQERKERDTQRKGRRAKNNIRAHQGELVEEKESFEHDIGSPHEANKEEFQ
QVKSKAHPPAISEENYAIHDELKQVDPLSPEEYSDEGWQAANLRGRSANVRKKSSRRRPA
LTKLMVDRLEDGRTGSAYRAGVQQHMKGDKEDVINSSSQLSFGSFLKTDKVNGNSSNIEN
KVFNAISKPERGIKLSGINRPATIASKLVSYKDVAVSPPGTVLKPILEQKEAKEKDNAQN
TDLIVSSEEEDKKLTDEDEEKEKPSHDSSKEVLSSEPEEIGNDEKAPDSNSDESPTESKK
KGGSKLSASAPPFNPGSLLSMSHPYSTVAIYDASVVLQPIPSQPMEILPHAIDTRVPRGP
RSTLYYRTGHTFQRKQGYAHSQSTILRGSNSPPTMNPHAAEFVPGKTSQQPDVANREPSA
DVSVTDSADQLLAPQTSDEVKAGMPAAEQAIQGESTSPCKGKENRAKDALRNSCKTELAR
QILFSFIVKSVHDSLGSTGAESDRKPSGPDESGNAQSSNNINKSPSGRKELDKQQKATVV
PKSEKDTEGFTVVSKRRRSKQHFVHPIHGLYSQQSICTSVS*

5'UTR

chr04:32843625..32843626 (+ strand) : 2 bp

CDS

chr04:32843627..32843677 (+ strand) : 51 bp

chr04:32843810..32843914 (+ strand) : 105 bp

chr04:32844025..32844158 (+ strand) : 134 bp

chr04:32844521..32844704 (+ strand) : 184 bp

chr04:32845318..32845449 (+ strand) : 132 bp

chr04:32845539..32845651 (+ strand) : 113 bp

chr04:32845720..32845801 (+ strand) : 82 bp

chr04:32846420..32848084 (+ strand) : 1665 bp

3'UTR

chr04:32848085..32848285 (+ strand) : 201 bp

FASTA

>Os04t0645100-02 class=Sequence position=chr04:32843625..32848285 (+ strand)
AGATGGCTTT GGATAAAGGA AAACTTGATG ATGCCGTCAA CTTCGGAACA AAGGTATGCA ATAATCAGTT CTTTTTTCTG
TACGTTGTTT AACAGCTATG CTAAAATATT TCTCTTCCTG CTTTGGTTGG GTGAAGTTAC CATTCTAAAT TCTTTCATTA
ACTATTTTTT TTTCTTTTCT TGAAGGCGTT GTCCAAAATT GTAGCAGTTT GTGGTCCATA CCATCGGCTG ACTGCTAATG
CGTACAGTCT TCTTGCTGTA GTTCTTTACC ATACTGGAGA TTTTAATCAG GTATTTCAAT GAATTTGGTG GGCTGTATTC
TATCTGCTGC ATAGTGATGT GTTTTTGGCA CAATGTTTGG CAACTGCATT TTTCACTAGA CTTCTGTTCT TTCTCTGTAG
GCAACTATAT ATCAGCAGAA GGCACTTGAT ATCAATGAAA GAGAGCTAGG TCTTGACCAC CCAGAAACTA TGAAGAGTTA
CGGGGATTTA TCTGTCTTCT ACTACCGTCT CCAGCACATC GAAATGGCTC TAAAGTAAGT GCTGCTATTA GGTGTTTTGT
TGTGGAAACA CAAAAGCTAG TTTCATGACT TGGCTTGTAG CTGGTATTAC TATCATGCAC AATGTCGTTA CGCTGGTTCA
TTTCTAGCCA TTACATGCAT TAAATATATT GCCTGTAGAA TGGATACTAC TGCATTTGTA CGGCACTATG GCTGTATTAA
TTTGTAGACT TGAACTGTGC ATTGTTTTGC ATTATTGTCC ATGATTGTTA CTTGTGGTTT GCACGGAAAC TTGCTGAAGG
CACATATTTG CTTGACAATA TTGTCAAAAC TCATCTTCCA TCTTTCTTTT TTTGCCTTTT GTTTTTTGTA TCGCTAATGG
TATCTTTTTC TTAAAGGTAT GTCAACCGTG CACTATATCT ACTCCAATTT TCTTGTGGGC TTTCACATCC AAATTCAGCT
GCCACATACA TAAATGTGGC TATGATGGAA GAAGGTATGG GAAATGTTCA TGTCGCTCTC AGGTACTTGC ATGAAGCACT
GAAGTGCAAC AAGAGACTGC TAGGAGCTGA TCACATTCAG GTAAACAAAA CTACATATTT TTCTCTTACC GTGCTTTCAC
AGCTTTATCT GTTTTCCTGG AAACAATAAT CTAATTGTTT TTTTTGTTGG ACTTGATTGA TGTGCATTAA AGTACAGTCT
TGTAAGATCA ATTCCATGCG TACTATCTCT TGCACCAATA TTTCTGCAGA AGTACTGGCA TTGGCGGCAT ACTTGTCTTA
TTAAGGATAT TAGACATATA CACCTCTGAT ACAGTAGAAA TGTCCCATAA GTATCTATGT CTGAAGCAAA CTTTTTGATT
TAGCTCTAAT ATCCCTAGAT ATTCTCCATT GCTGTCCCTC AAAGGCCATG AGCAATTGTT TAAGTTTCTT TCAATTTCCT
ATCCAACTTG TTTATTGCAT ATCCAATTTC AAAACTAGCA TCTTGTTTCA GTAGTACCCG CGCCACCATG ACTTGTATCT
TTTAAGGAAA GGTTTATTTT GATGTCTAGA CCCACAGAAA CAGTCTTTTC TGTATATTTC AATCCGTTTG ACATAATGCA
TGTAACTACG GACAACTTCA ATGGCGTATT TGTTATGCAT ATGATCCCGT GATTCAGTTA ACATGAATTT TCATGCATTT
CTTTGAACAA CAGACTGCTG CGAGCTATCA TGCCATAGCC ATAGCCCTCT CAATGATGGA TGCATACTCC TTGAGTGTTC
AGCATGAACA GACCACCTTA CAGATACTTC AGGAGAAACT AGGACAAGAT GACCTTCGAA CTCAGGTTTT TTTTCCCTTC
AAAATATGCA ATGACGAGTC CAAATACTGC TATGTTCTCT TGGACTATTA GACATGATAA TTTTCCTGCT GCAGGATGCT
GCTGCATGGC TTGAGTATTT TGAGTCAAAA GCATTAGAAC AACAAGAGGC CGCCCGAAGG GGCATCCCAA AACCTGACTC
ATCTATTGCA AGCAAAGGAC ATCTTAGGTA TGAATACACT GTGCATTATC AGTCGCAAAC TGTGATGATC TGGATTGAAA
CATTTATCTT TCCAGTGTAT CAGATCTACT TGACTACATA AGCCCGGATC AGGAAAGAAA AGAGAGGGAT ACACAAAGAA
AGGGCAGGCG TGCAAAGGTG ATTATAACAT GCCTACTTTT TCAAAATTAT TGTTGTTAAA ATGTAGTCAG AAGAGATAAG
TGCACACTGG ACAGTGGAGA CAATTCCATC AGTATTCATG AAAAGTCTAG ATGAGAATAG GATTGGCACA ATAACTTCCA
TATAGGATGT CTGGTATATG AACTGATGAA CATATGCTGG CAGCAAATCA GCAATCCTAT CCAGTTCATG AAACTAGTAA
AAGGTTATGA ACCATCATCA CTGACATAAT AACCATGACA GTTATCCCCA CCAGTCATTG TTGGAGCATG AACTATGAGA
ATTGAAAAGA TATTCCCGCA TCCACAGCTA GTCCATTGAT ACCAGGCATT TATCCAGATG ATTCCAGTTC AACCCATTAA
CTTAGCAATG AATTGACAAC ACAATTTCTT CTTAGTTGGG AATTTAACTC CCTTTACATA TGGATATTTA ATCCTTTGTT
TTCTAATATG CTTCATGAAT TGGGAATCAC AATATACATA TTTTGGAAGT CCATTGATGT CATGGTTTCA ATTGTTGCCT
AAACATTATG CAAGCTTTTA TTTTACCCTT ACTACCCTTT GCTTTCCTTT TCACCTTGTA TAGTATTAAA TGCAGAATAA
TATCAGAGCC CATCAAGGTG AATTAGTTGA AGAAAAGGAG AGCTTTGAGC ACGACATAGG ATCTCCTCAT GAAGCAAACA
AAGAGGAGTT TCAACAAGTA AAATCGAAGG CACACCCTCC AGCAATATCA GAAGAAAATT ATGCTATCCA TGATGAGCTG
AAGCAAGTTG ATCCTTTATC ACCTGAAGAA TATTCTGATG AAGGGTGGCA AGCAGCTAAT TTGCGTGGAC GATCTGCAAA
TGTACGGAAG AAAAGCAGTC GCAGAAGGCC CGCTCTCACT AAATTAATGG TTGATCGCTT GGAAGATGGC CGCACAGGTT
CTGCTTATAG GGCTGGTGTA CAACAACACA TGAAAGGAGA TAAAGAAGAT GTTATAAACT CTTCTAGCCA GCTCTCCTTT
GGCAGCTTTC TAAAAACTGA CAAGGTGAAT GGGAATTCCA GCAATATTGA AAATAAGGTT TTCAATGCTA TATCTAAACC
AGAACGAGGC ATAAAGCTTT CAGGAATTAA CAGACCTGCT ACTATAGCTT CCAAGTTGGT ATCATACAAA GATGTAGCAG
TGTCACCCCC TGGCACAGTC TTGAAACCGA TTTTGGAGCA GAAGGAAGCA AAGGAGAAGG ATAATGCACA AAATACTGAT
CTAATAGTGT CATCTGAGGA GGAAGATAAG AAGTTAACAG ATGAAGATGA AGAAAAGGAA AAGCCAAGTC ATGACAGCAG
CAAAGAGGTT CTTTCAAGTG AACCAGAGGA AATCGGCAAT GATGAAAAAG CTCCGGACAG CAACAGTGAT GAAAGCCCAA
CTGAATCTAA GAAAAAAGGT GGAAGCAAGC TTTCAGCTTC AGCGCCTCCA TTCAATCCTG GATCACTCTT ATCGATGTCG
CACCCTTACA GTACAGTGGC AATATATGAT GCTAGCGTCG TTCTTCAGCC AATACCAAGT CAACCAATGG AGATTCTCCC
TCACGCCATT GATACTAGGG TACCCCGTGG TCCTCGGTCC ACATTGTACT ACCGTACTGG GCATACCTTC CAAAGAAAAC
AGGGTTACGC ACACAGCCAG AGCACCATTC TGAGGGGTAG CAACTCCCCC CCAACCATGA ATCCTCATGC TGCCGAGTTT
GTGCCTGGAA AAACTTCGCA ACAACCTGAT GTGGCTAACA GAGAGCCTAG TGCAGATGTT TCTGTAACTG ATTCAGCAGA
TCAACTGTTG GCACCACAGA CATCAGATGA AGTAAAGGCT GGTATGCCTG CAGCAGAACA AGCAATTCAA GGTGAGAGCA
CCAGCCCATG CAAAGGAAAG GAAAACAGAG CGAAAGATGC CTTGAGAAAC TCATGCAAAA CAGAGCTGGC AAGGCAGATT
TTGTTCAGTT TCATCGTCAA GTCAGTACAT GATAGCTTAG GTTCCACTGG AGCTGAATCG GACAGAAAAC CAAGTGGACC
AGACGAATCT GGTAATGCAC AGAGCAGCAA CAACATAAAC AAGAGTCCGT CAGGTCGCAA AGAGCTTGAC AAACAGCAGA
AGGCCACCGT GGTACCTAAG AGTGAGAAGG ATACAGAAGG ATTTACAGTA GTTTCAAAAC GTAGAAGAAG CAAGCAGCAC
TTTGTGCATC CCATACATGG TCTCTATTCC CAGCAGTCAA TTTGCACTTC TGTCAGCTAA AGGTCCCGGT AGATCTCTTT
TTGGGAGTCG CCATATTTTG GAAGAAAGGT ATCGCTTAAT TACTTAGCTT AGACGCTTGG TAGCAAAAGT CTTACCCTAT
CCAGATGATC GAGAGCATGT AGTGAAACTG TACAAAGCTT TCCGCAATGT CTTTTGTGTA ATAAATTTTG TAATTTTGGG
GTAGCAGCCG CATCAGCGCT G

Locus: Os04g0645100

Loading...

Locus: Os04g0645100

Loading...