Os04t0644100-01

Locus

Os04g0644100

Description

Sterile alpha motif homology domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK106954 (DDBJ, Best hit)

Protein Evidence

Q25A62 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Sterile alpha motif, type 2 (IPR011510)

Sterile alpha motif/pointed domain (IPR013761)

Full-length cDNA

002-119-E07 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0644100-01)

RiceXPro (AK106954)

Others

KEGG (Os04t0644100-01)

Transcript

829 bp

>Os04t0644100-01 Sterile alpha motif homology domain containing protein.
GATCATCCGATCGGGCAGAGGCGGAGAAGAGAGTCACGTGAGCGGAGAAGATTCCGGCGG
CGGCGAAGTGAAGTGAAGAGGCGATGGGAATGGACTGGTACGCGTGGCTGTCGGCGGCGA
GGCTGGACCAGGCGGTGGCGTACGAGTACGCGCTGGTGTTCTCGCGCAACGAGCTGGAGG
CCGACGACCTCGCCTACTTCGACCACGAGTTCCTCCACAGCATGGGCGTCTCCGTCGCAA
AGCACCGCCTCGAGATCCTCAAGCTGGCGCGCCGGAGCCGCCGCCGCGCGGCGCTGTCGT
CGCGCCTCGTCGCCGCCGTCGACCGCGTCGCCAGGTACGTGCGCGCGCTCGTCGTCGTCG
TCGTCCAGGGCCGGGAGGACGAGTCGTCCTCGGCGCTCGTGCTCGTGCCGAGCCAGCAGC
TGCAGCCCGACGTCGACAAGACGCCGAGGAGGAGCAGGTCCAAGCCCAAGTCGACCAAGG
AGGTCGCCGCCGACGCCGCCGCTCCCACCACACCGAAAGCCATGCGGTCGCCGGTGCTGG
CCATCGGCGGCAGGGCCGCCTCGACGGTGCACGCCGTGAAGGACGGCGAGAAAGGCGGTG
AGGACATGGTCAGGTGGGACCGCCTGTTCCAGGACCTCAAGCCCAACTGAGCGCGCAACG
ACGACGATGCCGCGCGTGATCGCGGCGCCGGCGGCGGATGCAGCGGTGTGTTACTGTTAG
GGTTTAATGCTTGTTCATCTCCATGCTTTGGTAATGGTCGAGCACTGTGCTCTTTCTTCC
TCCTGCATGCACAGTTGTGCACTGCTCCGGCGCCATTGCTGCATGTACA

CDS

567 bp

>Os04t0644100-01 Sterile alpha motif homology domain containing protein.
ATGGGAATGGACTGGTACGCGTGGCTGTCGGCGGCGAGGCTGGACCAGGCGGTGGCGTAC
GAGTACGCGCTGGTGTTCTCGCGCAACGAGCTGGAGGCCGACGACCTCGCCTACTTCGAC
CACGAGTTCCTCCACAGCATGGGCGTCTCCGTCGCAAAGCACCGCCTCGAGATCCTCAAG
CTGGCGCGCCGGAGCCGCCGCCGCGCGGCGCTGTCGTCGCGCCTCGTCGCCGCCGTCGAC
CGCGTCGCCAGGTACGTGCGCGCGCTCGTCGTCGTCGTCGTCCAGGGCCGGGAGGACGAG
TCGTCCTCGGCGCTCGTGCTCGTGCCGAGCCAGCAGCTGCAGCCCGACGTCGACAAGACG
CCGAGGAGGAGCAGGTCCAAGCCCAAGTCGACCAAGGAGGTCGCCGCCGACGCCGCCGCT
CCCACCACACCGAAAGCCATGCGGTCGCCGGTGCTGGCCATCGGCGGCAGGGCCGCCTCG
ACGGTGCACGCCGTGAAGGACGGCGAGAAAGGCGGTGAGGACATGGTCAGGTGGGACCGC
CTGTTCCAGGACCTCAAGCCCAACTGA

Protein

189 aa

>Os04t0644100-01 Sterile alpha motif homology domain containing protein.
MGMDWYAWLSAARLDQAVAYEYALVFSRNELEADDLAYFDHEFLHSMGVSVAKHRLEILK
LARRSRRRAALSSRLVAAVDRVARYVRALVVVVVQGREDESSSALVLVPSQQLQPDVDKT
PRRSRSKPKSTKEVAADAAAPTTPKAMRSPVLAIGGRAASTVHAVKDGEKGGEDMVRWDR
LFQDLKPN*

5'UTR

chr04:32773316..32773398 (+ strand) : 83 bp

CDS

chr04:32773399..32773965 (+ strand) : 567 bp

3'UTR

chr04:32773966..32774144 (+ strand) : 179 bp

FASTA

>Os04t0644100-01 class=Sequence position=chr04:32773316..32774144 (+ strand)
GATCATCCGA TCGGGCAGAG GCGGAGAAGA GAGTCACGTG AGCGGAGAAG ATTCCGGCGG CGGCGAAGTG AAGTGAAGAG
GCGATGGGAA TGGACTGGTA CGCGTGGCTG TCGGCGGCGA GGCTGGACCA GGCGGTGGCG TACGAGTACG CGCTGGTGTT
CTCGCGCAAC GAGCTGGAGG CCGACGACCT CGCCTACTTC GACCACGAGT TCCTCCACAG CATGGGCGTC TCCGTCGCAA
AGCACCGCCT CGAGATCCTC AAGCTGGCGC GCCGGAGCCG CCGCCGCGCG GCGCTGTCGT CGCGCCTCGT CGCCGCCGTC
GACCGCGTCG CCAGGTACGT GCGCGCGCTC GTCGTCGTCG TCGTCCAGGG CCGGGAGGAC GAGTCGTCCT CGGCGCTCGT
GCTCGTGCCG AGCCAGCAGC TGCAGCCCGA CGTCGACAAG ACGCCGAGGA GGAGCAGGTC CAAGCCCAAG TCGACCAAGG
AGGTCGCCGC CGACGCCGCC GCTCCCACCA CACCGAAAGC CATGCGGTCG CCGGTGCTGG CCATCGGCGG CAGGGCCGCC
TCGACGGTGC ACGCCGTGAA GGACGGCGAG AAAGGCGGTG AGGACATGGT CAGGTGGGAC CGCCTGTTCC AGGACCTCAA
GCCCAACTGA GCGCGCAACG ACGACGATGC CGCGCGTGAT CGCGGCGCCG GCGGCGGATG CAGCGGTGTG TTACTGTTAG
GGTTTAATGC TTGTTCATCT CCATGCTTTG GTAATGGTCG AGCACTGTGC TCTTTCTTCC TCCTGCATGC ACAGTTGTGC
ACTGCTCCGG CGCCATTGCT GCATGTACA

Locus: Os04g0644100

Loading...

Locus: Os04g0644100

Loading...