Os04t0648800-01

Locus

Os04g0648800

Description

C3HC4 RING domain-containing E3 ubiquitin ligase, Modulation of heading date by physically interacting with Hd1

RAP-DB Gene Symbol Synonym(s)

OsHIP1, HIP1, HAF1, OsHAF1

RAP-DB Gene Name Synonym(s)

OsHAL3-interacting protein 1, Heading date Associated Factor 1

CGSNL Gene Symbol

HIP1

CGSNL Gene Name

HAL3-INTERACTING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

OsHIP1, HAF1, OsHAF1

Oryzabase Gene Name Synonym(s)

OsHAL3-interacting protein 1, Heading date Associated Factor 1

Transcript Evidence

AK071468

Protein Evidence

Q7XTV7

Literature

PMID: 26296966

PMID: 19543273

Note

Manual Curation

October 16, 2015

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-type (IPR001841)

Full-length cDNA

J023098C19 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0648800-01)

RiceXPro (AK071468)

Others

Oryzabase (14741)

KEGG (Os04t0648800-01)

Transcript

2743 bp

>Os04t0648800-01 C3HC4 RING domain-containing E3 ubiquitin ligase, Modulation of heading date by physically interacting with Hd1
ATCCTCTCATCACCACCACCACCCCACCTCCTTCTCTCCCTGTCTTTCTCCTTCTCCTCC
TCCTTCCTCTCGCTCTCTCCTCCTTGACAAAATTTCCTCCACCCATTCCCTTCTCCACCC
ACCCTGCCGATCTCTCTGAATTCGGTCGCCTCCTCCGCACCATCTTTCTCTCCTCCTCTC
TTCTAGCAATCGGTCGTTTCCTCCGGTTGTTGTGCTGATTCTTCGTTCTTTCTCTCCCTC
TCTCTCTCTTTCTTTCTTCCTCTCTCTGCCTTGGAGAGGATCAAGAAACGAAGGGAGGGA
GGAGAGGAGAGGAGAAGGGAAATCGAGAAAAGTCTGTTCTTTGGTTTGGCTCGTGTGGTT
CTTGAGAGCTGCTGTTTGGAAAATCTCTGCACCTGTTGCTGACCACTTGCTTCAATTGTT
GAAAGAGATGAACAGCACCTGAGATGCTATTGCCAGACATCAATTGATAAAGAGCACATC
TTCAGTAATGCAAGGACAGAAGAACTCTGTTGAGCAGCTTGCTGATGTGTTTGGATTTGA
CCATGCATCCAGTTCAGGAAACCCTGTCATGGATCAACAAGGATATTGGAACAACATTCT
TGGTTCAGTGGAGTCACATAACCTTCAAGGTTATCAGGTGAACCGTAGTGATGGAACTAT
TCCCTATGGAAACGGTGTGCATCAAAATGGCACTTTTTTAGGTTTTTGGGAATCAGGCGA
AGCAAGTGCAAGTGGCAGTTCACTACATTTTGGGGGCTCTAATGAGATCAAAGCTGAGCA
ACGTAATATCGGTGGTGGCCTAAGGATTGGTGAAAGGCGCTTGGTAGCTGAGCGCAACCT
TTCTTTGGATAATGTTGATATAGGCCTTAACATCAATGGTAATGATCTATCTGGTGAAAA
TTCAAATGTGAATGGTGCTTCACAAGGCTCTGAACTACATGGTGGCTGCTCTCATACTGG
TTCAAATGGTCAAGCCTCTGAGCTGAGATTACATCCATACAGGACATTCATATTAGGTGC
AGATCAACCTGAGCCTTTTAATTCTTTGAATGGCAGTGAAAATCCTTTAGGTGATTTTTC
CTTGATGCCAGAAGGCATTGATCAGCGACCAGGCAGTTCCCTGGATGGCCGCCGGCTGGC
ATGCAAGAGGAAAAATATAGAAGGAGTTAATGGGCAGTGCTCGGCAGGTGCTAGCACTAG
TTTTTCCCACAGGAACGATAGTATTTTCCATAACATTGCTTCTTCGAGTCATAATCCCTC
TCCTAGTACAAATTTACCCTCTCCTAATTGTCTGTTGGTTCCAAGCACTCTTGATGAACA
ACTCCCGCGTTATGGAGCTACTACAGCTGGATTGTCATCTAGTAGCTATGATCCTAGTGG
AGGCAATAACAATTCAGGAGGCTCACAAAGAAGTTTTCGGCCAAGAACTAGCCTGGCTCA
ACATATTGGCCCCTATGGTGTGTGGCCATCTTCAAGTACTATCAGACATTCCAATTCATG
GAATCATCAGCCACCTCCCTTTCAGAGTTCATTTGATGAACCACCGGAGGTAATTCCAGT
GGTCAGTAGCCTGAACTTTCAATACCAGCATCCAATGAATGTCGTTCCTGGCATTCCACA
GATGTCACACCGGTTCACTGGTCCAGGGGCCTCATCATCAAGAACAGGCAATTTGGAGAA
CAGAATTATTGGTAGTGAGGAATTTAGCGCGAGGAATGTAGTGGCTACCAGCTTCCCTGA
TGCAGTTCCTCCGGCCGCACTAGACATGAGGCATTTGATACCAGAACCATCTAGTTGGAA
TGTAGATGGCAGAGCTACTACCATTCCAGGAAATGTTCCTTCTTCATCGAGAGCTAATAC
CAATTCGATGGTTAATCCACCAGCAGGCTCTCCATTTATTGCCCATCAAAACTTGCATAG
ACGTAATCCTCGTAATTTGTCAGAGGAGATAAGTCGTTTATCTGGAGCTCTTCGTGGCCA
TCAGCACCCACGCCTAAGGTCCGGTTTTCTGTTAGAACGACAAGGTGATGGTGTTTGGGG
TGTTCCGTTGTCAACTAGGAGCAGGGAAGGAAGAAGATTAATTGAGATCCGGAACGCGCT
TGAAATGATTCACAGAGGGGAAAATGTAAGATTTGAGTCCATTTTCTATGGTGGAGTCGA
CATTCATGACAGACACAGGGATATGCGCCTTGACATAGACAACATGTCTTATGAGgagct
attggcactggaagaaagaataggcaatgttagcactggcctcagtgaggaagaagtgac
aaaGCTCCTAAAGCAAAGGAAATTCTCATCATGGAGGTTGGAAGCATCTGTGGAAGAAGA
GCCATGCTGTATCTGCCAGGAAGAGTATGTTGATGGGGATGATCTCGGGACACTGGACTG
TGGACATGACTTCCATGTTGGATGCGTCAGGCAATGGCTGGTTGTGAAGAACACCTGTCC
CATATGCAAAAATACTGCTCTGAAGTCTTAGAAAAAGCACAGGGCAGTAAACACTGTGTG
CTTGTTCGATCGCAAGATCGTTTAGTGATTCATATTACCGTGCCGTTTTTTGATTAGAAA
TTTTTTTTGCCATTGACCTACAAATTTGATTAAAAAAAAAGGTAAAAGAACTGGTCCCTG
CAAACTGCCCCCTCCTGCAGTAAATAATCCCTGGAATCTGTCGCTCTGCATTCAACTGAA
TATTTATGGCTGGTATATTGGATGATGGCTCAATATTTTTTTC

CDS

2004 bp

>Os04t0648800-01 C3HC4 RING domain-containing E3 ubiquitin ligase, Modulation of heading date by physically interacting with Hd1
ATGCAAGGACAGAAGAACTCTGTTGAGCAGCTTGCTGATGTGTTTGGATTTGACCATGCA
TCCAGTTCAGGAAACCCTGTCATGGATCAACAAGGATATTGGAACAACATTCTTGGTTCA
GTGGAGTCACATAACCTTCAAGGTTATCAGGTGAACCGTAGTGATGGAACTATTCCCTAT
GGAAACGGTGTGCATCAAAATGGCACTTTTTTAGGTTTTTGGGAATCAGGCGAAGCAAGT
GCAAGTGGCAGTTCACTACATTTTGGGGGCTCTAATGAGATCAAAGCTGAGCAACGTAAT
ATCGGTGGTGGCCTAAGGATTGGTGAAAGGCGCTTGGTAGCTGAGCGCAACCTTTCTTTG
GATAATGTTGATATAGGCCTTAACATCAATGGTAATGATCTATCTGGTGAAAATTCAAAT
GTGAATGGTGCTTCACAAGGCTCTGAACTACATGGTGGCTGCTCTCATACTGGTTCAAAT
GGTCAAGCCTCTGAGCTGAGATTACATCCATACAGGACATTCATATTAGGTGCAGATCAA
CCTGAGCCTTTTAATTCTTTGAATGGCAGTGAAAATCCTTTAGGTGATTTTTCCTTGATG
CCAGAAGGCATTGATCAGCGACCAGGCAGTTCCCTGGATGGCCGCCGGCTGGCATGCAAG
AGGAAAAATATAGAAGGAGTTAATGGGCAGTGCTCGGCAGGTGCTAGCACTAGTTTTTCC
CACAGGAACGATAGTATTTTCCATAACATTGCTTCTTCGAGTCATAATCCCTCTCCTAGT
ACAAATTTACCCTCTCCTAATTGTCTGTTGGTTCCAAGCACTCTTGATGAACAACTCCCG
CGTTATGGAGCTACTACAGCTGGATTGTCATCTAGTAGCTATGATCCTAGTGGAGGCAAT
AACAATTCAGGAGGCTCACAAAGAAGTTTTCGGCCAAGAACTAGCCTGGCTCAACATATT
GGCCCCTATGGTGTGTGGCCATCTTCAAGTACTATCAGACATTCCAATTCATGGAATCAT
CAGCCACCTCCCTTTCAGAGTTCATTTGATGAACCACCGGAGGTAATTCCAGTGGTCAGT
AGCCTGAACTTTCAATACCAGCATCCAATGAATGTCGTTCCTGGCATTCCACAGATGTCA
CACCGGTTCACTGGTCCAGGGGCCTCATCATCAAGAACAGGCAATTTGGAGAACAGAATT
ATTGGTAGTGAGGAATTTAGCGCGAGGAATGTAGTGGCTACCAGCTTCCCTGATGCAGTT
CCTCCGGCCGCACTAGACATGAGGCATTTGATACCAGAACCATCTAGTTGGAATGTAGAT
GGCAGAGCTACTACCATTCCAGGAAATGTTCCTTCTTCATCGAGAGCTAATACCAATTCG
ATGGTTAATCCACCAGCAGGCTCTCCATTTATTGCCCATCAAAACTTGCATAGACGTAAT
CCTCGTAATTTGTCAGAGGAGATAAGTCGTTTATCTGGAGCTCTTCGTGGCCATCAGCAC
CCACGCCTAAGGTCCGGTTTTCTGTTAGAACGACAAGGTGATGGTGTTTGGGGTGTTCCG
TTGTCAACTAGGAGCAGGGAAGGAAGAAGATTAATTGAGATCCGGAACGCGCTTGAAATG
ATTCACAGAGGGGAAAATGTAAGATTTGAGTCCATTTTCTATGGTGGAGTCGACATTCAT
GACAGACACAGGGATATGCGCCTTGACATAGACAACATGTCTTATGAGgagctattggca
ctggaagaaagaataggcaatgttagcactggcctcagtgaggaagaagtgacaaaGCTC
CTAAAGCAAAGGAAATTCTCATCATGGAGGTTGGAAGCATCTGTGGAAGAAGAGCCATGC
TGTATCTGCCAGGAAGAGTATGTTGATGGGGATGATCTCGGGACACTGGACTGTGGACAT
GACTTCCATGTTGGATGCGTCAGGCAATGGCTGGTTGTGAAGAACACCTGTCCCATATGC
AAAAATACTGCTCTGAAGTCTTAG

Protein

668 aa

>Os04t0648800-01 C3HC4 RING domain-containing E3 ubiquitin ligase, Modulation of heading date by physically interacting with Hd1
MQGQKNSVEQLADVFGFDHASSSGNPVMDQQGYWNNILGSVESHNLQGYQVNRSDGTIPY
GNGVHQNGTFLGFWESGEASASGSSLHFGGSNEIKAEQRNIGGGLRIGERRLVAERNLSL
DNVDIGLNINGNDLSGENSNVNGASQGSELHGGCSHTGSNGQASELRLHPYRTFILGADQ
PEPFNSLNGSENPLGDFSLMPEGIDQRPGSSLDGRRLACKRKNIEGVNGQCSAGASTSFS
HRNDSIFHNIASSSHNPSPSTNLPSPNCLLVPSTLDEQLPRYGATTAGLSSSSYDPSGGN
NNSGGSQRSFRPRTSLAQHIGPYGVWPSSSTIRHSNSWNHQPPPFQSSFDEPPEVIPVVS
SLNFQYQHPMNVVPGIPQMSHRFTGPGASSSRTGNLENRIIGSEEFSARNVVATSFPDAV
PPAALDMRHLIPEPSSWNVDGRATTIPGNVPSSSRANTNSMVNPPAGSPFIAHQNLHRRN
PRNLSEEISRLSGALRGHQHPRLRSGFLLERQGDGVWGVPLSTRSREGRRLIEIRNALEM
IHRGENVRFESIFYGGVDIHDRHRDMRLDIDNMSYEELLALEERIGNVSTGLSEEEVTKL
LKQRKFSSWRLEASVEEEPCCICQEEYVDGDDLGTLDCGHDFHVGCVRQWLVVKNTCPIC
KNTALKS*

5'UTR

chr04:33022835..33023235 (+ strand) : 401 bp

chr04:33024324..33024409 (+ strand) : 86 bp

CDS

chr04:33024410..33025867 (+ strand) : 1458 bp

chr04:33025955..33026095 (+ strand) : 141 bp

chr04:33026698..33026748 (+ strand) : 51 bp

chr04:33027198..33027275 (+ strand) : 78 bp

chr04:33027349..33027492 (+ strand) : 144 bp

chr04:33027975..33028106 (+ strand) : 132 bp

3'UTR

chr04:33028107..33028358 (+ strand) : 252 bp

FASTA

>Os04t0648800-01 class=Sequence position=chr04:33022835..33028358 (+ strand)
ATCCTCTCAT CACCACCACC ACCCCACCTC CTTCTCTCCC TGTCTTTCTC CTTCTCCTCC TCCTTCCTCT CGCTCTCTCC
TCCTTGACAA AATTTCCTCC ACCCATTCCC TTCTCCACCC ACCCTGCCGA TCTCTCTGAA TTCGGTCGCC TCCTCCGCAC
CATCTTTCTC TCCTCCTCTC TTCTAGCAAT CGGTCGTTTC CTCCGGTTGT TGTGCTGATT CTTCGTTCTT TCTCTCCCTC
TCTCTCTCTT TCTTTCTTCC TCTCTCTGCC TTGGAGAGGA TCAAGAAACG AAGGGAGGGA GGAGAGGAGA GGAGAAGGGA
AATCGAGAAA AGTCTGTTCT TTGGTTTGGC TCGTGTGGTT CTTGAGAGCT GCTGTTTGGA AAATCTCTGC ACCTGTTGCT
GGTACGGTTT GCTGCATCTC TCTGTGTCTA TGTTTTTGTT TAATTTCTCT TGTTCTTTTG ATTCTGCATG GTGGCCTGCC
ATACTCTTTG GTTGGAAATC TATGGTTCCT TTGCAATACA TGTCCTTTCT TGTGTTGATT CTTTCGTGGT TCATCCCACG
AGATGTTTTC TACAGTCCGG AATGTGTCAA ATGCTATTAA ACCGTGAAAA ATTCGTGTTT TTCTTTTTCA TAAACACATT
TCTTCAAACT TTGTAAACGG TACGTTTCTC TTTGCTTGGT GTTACGGTGA GAAACAGAGA TGACTTGGTG TTCTTGGTTG
GTTAAATTCC TCCCTGTGTT GGTTGCCTTT CAATTTCGTC ACGAGAAAAT CAACCTGTCC CTTGAAACCG TGGATCGCCG
CTTCTACCTT TTCTTTCCGT TTGTCTTTTT TACTTAAAAC TTCTTTTTTT TTTGCAAACC GAAAAGGAAG GGAATTAAAT
GCAAATAAAA TGAGAGTAGT AGTAGTATAT TTTTTGGATT GTCCACAGAG GCAATGGGGC CCATCTTGCA TGCAGTCCAT
CTGTTTAGGT CGCATGCAAT GTACAATCAC CGTGTCTCAC ACTCATTAAA TTGCATGCAT CAGCACAACC TTTGCTTACA
ACAGCCCAAA CCATCAAGTT TGGTGCATCC ATATACCTCA CCAAATGCGG TTCATGCCAA GATTGCTACA GTAAAATTAG
TTAATGCTCT CATCAATGAC AGAATGAATT GCTATTCTGT AAAACCCAAA CTAGTCTTCC TGCTTCTGGA TAGTAACCCT
TTTATCAAAA AGAATAACTT TCTGATAGCC GAGTCATGAA CAAAAGATTT GTCTGTTCAC ATTTCTATAG ATGTTAATTA
GTTAAAGATA GTATATAACA ATAGGATTAG ACTTGCGTTG TTCAGTAACA TAATGACTGA AATTCAGCAG AACCTAGCGT
GTGATGAACC GTAGCATTCA ACATTCCTTC AATTTGAGAC TGTTTGTTTG CTTCTTCTGT ACGGGCAATG CTAAGAACAT
ATTTTTTACC CAAAATTCTA ATATCTTACA ATCTTTCTTA CATTTGCAGA CCACTTGCTT CAATTGTTGA AAGAGATGAA
CAGCACCTGA GATGCTATTG CCAGACATCA ATTGATAAAG AGCACATCTT CAGTAATGCA AGGACAGAAG AACTCTGTTG
AGCAGCTTGC TGATGTGTTT GGATTTGACC ATGCATCCAG TTCAGGAAAC CCTGTCATGG ATCAACAAGG ATATTGGAAC
AACATTCTTG GTTCAGTGGA GTCACATAAC CTTCAAGGTT ATCAGGTGAA CCGTAGTGAT GGAACTATTC CCTATGGAAA
CGGTGTGCAT CAAAATGGCA CTTTTTTAGG TTTTTGGGAA TCAGGCGAAG CAAGTGCAAG TGGCAGTTCA CTACATTTTG
GGGGCTCTAA TGAGATCAAA GCTGAGCAAC GTAATATCGG TGGTGGCCTA AGGATTGGTG AAAGGCGCTT GGTAGCTGAG
CGCAACCTTT CTTTGGATAA TGTTGATATA GGCCTTAACA TCAATGGTAA TGATCTATCT GGTGAAAATT CAAATGTGAA
TGGTGCTTCA CAAGGCTCTG AACTACATGG TGGCTGCTCT CATACTGGTT CAAATGGTCA AGCCTCTGAG CTGAGATTAC
ATCCATACAG GACATTCATA TTAGGTGCAG ATCAACCTGA GCCTTTTAAT TCTTTGAATG GCAGTGAAAA TCCTTTAGGT
GATTTTTCCT TGATGCCAGA AGGCATTGAT CAGCGACCAG GCAGTTCCCT GGATGGCCGC CGGCTGGCAT GCAAGAGGAA
AAATATAGAA GGAGTTAATG GGCAGTGCTC GGCAGGTGCT AGCACTAGTT TTTCCCACAG GAACGATAGT ATTTTCCATA
ACATTGCTTC TTCGAGTCAT AATCCCTCTC CTAGTACAAA TTTACCCTCT CCTAATTGTC TGTTGGTTCC AAGCACTCTT
GATGAACAAC TCCCGCGTTA TGGAGCTACT ACAGCTGGAT TGTCATCTAG TAGCTATGAT CCTAGTGGAG GCAATAACAA
TTCAGGAGGC TCACAAAGAA GTTTTCGGCC AAGAACTAGC CTGGCTCAAC ATATTGGCCC CTATGGTGTG TGGCCATCTT
CAAGTACTAT CAGACATTCC AATTCATGGA ATCATCAGCC ACCTCCCTTT CAGAGTTCAT TTGATGAACC ACCGGAGGTA
ATTCCAGTGG TCAGTAGCCT GAACTTTCAA TACCAGCATC CAATGAATGT CGTTCCTGGC ATTCCACAGA TGTCACACCG
GTTCACTGGT CCAGGGGCCT CATCATCAAG AACAGGCAAT TTGGAGAACA GAATTATTGG TAGTGAGGAA TTTAGCGCGA
GGAATGTAGT GGCTACCAGC TTCCCTGATG CAGTTCCTCC GGCCGCACTA GACATGAGGC ATTTGATACC AGAACCATCT
AGTTGGAATG TAGATGGCAG AGCTACTACC ATTCCAGGAA ATGTTCCTTC TTCATCGAGA GCTAATACCA ATTCGATGGT
TAATCCACCA GCAGGCTCTC CATTTATTGC CCATCAAAAC TTGCATAGAC GTAATCCTCG TAATTTGTCA GAGGTAGCTT
TTCGCCTGCT CAGTTCAATA TGTTCCATTT TCAAATCGAT TTATCTTTTA GTAATCTTCT TGCGTTTTTT TCTTTTATAG
GAGATAAGTC GTTTATCTGG AGCTCTTCGT GGCCATCAGC ACCCACGCCT AAGGTCCGGT TTTCTGTTAG AACGACAAGG
TGATGGTGTT TGGGGTGTTC CGTTGTCAAC TAGGAGCAGG GAAGGAAGAA GATTAATTGA GGTATCAATT CTGCTCTCTT
TTTTTCCCTT CTCTTGCCTG CCTTGTTTCT GAACTAGGTC AGAAATCAGA ATAATGTTAT GTTTACATCC GTTTAGTGGA
CATACAGAAG CATCATTAGG AATAATATTC TGACGATCTT CTAAATCTCA TTTCCCCTTT GATCTCACAT GCTTCTTCGC
ATGTCTGCAG CCATCCACCT AATTCTGCGG TGGAAAGATA AACTTTAGTT TCTCACCAAT CTGAAAATGT TACGGCAGTT
GCTAAATTCC CCCCCCCCCT TACGCACCAT CATCTTGTAC CTAGTAGTGA CACTTAATTT TATTAACTCA ACAGAGAGAG
AGAGAGAGAG AGAGAGAGAG AGCACATATC TTGTTTTGGT TTTAAATGAC ACAGTGGATT AATAGTTATA AAATTCAATG
GACCGTTTAC CTTATGCATG CTACGTTTTG TTTCTAGCCG CATGTTATTC TCTAGAACTA TGTGGCTTGG ACAGGCAATA
ACTAGTGAGC CATCCATGTT GGATGCGTCG TTCATTTATT TACTTGTGTA ACCATGAAGT CTATGCAAGA CAATATGTTT
CTTACCTTTT TGCTTGTCAC CAGATCCGGA ACGCGCTTGA AATGATTCAC AGAGGGGAAA ATGTAAGATT TGAGGTCAGT
AACAACTGTG GTTTCGGAGT TACCTACAGT TGCCTATTTT TATCTGCACG GACTTGTAGA GATTGATGAA ACTATATTAT
GTCCTAAAAA CTCACAGCAA GACTGGCTGA CTAATACTAG TTGATGCTAG GATTACATAA GGTTTGCTCT GTCCATTCAG
TTTGGATGTA GAGGCTGGAT TCTAATCCAT TTTATAAAAG AGAGATCGCA TAAGGTGTTG TTTTGTTTCT GAAAACAGAA
GTTTCTTGTA ATATGGAAAT AGTATATAGT GAATGCATGA AAGACCATAG TATATCTATA ATTCAGAAAA ATATAGTCAT
CATTTCAACA GAGAGAAACA AATAGGCAAC AACTTGCACT GAACCCTTTT TTGTTTTCTA AAATCTTTGC TTATTTCTTG
AGGTATTTAC TCTTGCTTCC ACGTATATCT GTTCTTGCTA CAGTCCATTT TCTATGGTGG AGTCGACATT CATGACAGAC
ACAGGGATAT GCGCCTTGAC ATAGACAACA TGTCTTATGA GGTTGGTTTT CCTTAGCACA ATATTATCTG GATCTTTCTC
CAGCAAAACT CTGATAATtg ctgttgtctt ccaggagcta ttggcactgg aagaaagaat aggcaatgtt agcactggcc
tcagtgagga agaagtgaca aaGCTCCTAA AGCAAAGGAA ATTCTCATCA TGGAGGTTGG AAGCATCTGT GGAAGAAGAG
CCATGCTGTA TCTGCCAGGT ATAACTCAGG CCTATCAGAA GCTTGTGACA TAGTTTCCTT TGTTTAGTTA ACTTGAAATC
TAGCAGGTTC AGTGCTTTGT GCATTTAGCT TTGTTAATTG TACGCCATAC CTAATAGGTG ACATAAGCCT GTGAGTATGT
CCATTTTAAC TTGAAAAACA CTCATCTATC AATAATGTAG CTGTAATTAT CAATTAAGTC GGTCAGGCCT GTGAACCACT
ACCAGTTGGA CAACAATGCT CAACTTTTAA AACTTGTAGC TGAAAGTTGA ATATGATTTT GTTCAAGATT CCTAGTGCTG
CATATACTGA CCTACCCAAG CAAATATCTT ACCTTGGGAT ACACTTGAGG AATTGTCTTT GCTCAATATC TTCCTTTTTC
TTCATTGTCT TCTTAAATCA ATGAAAAGTT TTGGCAATTC TGCAAACTAA TAATTCATAT TGATGTCTTC TAACTATGTT
CGTTCTCGCT GTTTATCCAG GAAGAGTATG TTGATGGGGA TGATCTCGGG ACACTGGACT GTGGACATGA CTTCCATGTT
GGATGCGTCA GGCAATGGCT GGTTGTGAAG AACACCTGTC CCATATGCAA AAATACTGCT CTGAAGTCTT AGAAAAAGCA
CAGGGCAGTA AACACTGTGT GCTTGTTCGA TCGCAAGATC GTTTAGTGAT TCATATTACC GTGCCGTTTT TTGATTAGAA
ATTTTTTTTG CCATTGACCT ACAAATTTGA TTAAAAAAAA AGGTAAAAGA ACTGGTCCCT GCAAACTGCC CCCTCCTGCA
GTAAATAATC CCTGGAATCT GTCGCTCTGC ATTCAACTGA ATATTTATGG CTGGTATATT GGATGATGGC TCAATATTTT
TTTC

Locus: Os04g0648800

Loading...

Locus: Os04g0648800

Loading...