Os04t0648800-02

Locus

Os04g0648800

Description

Similar to Zinc finger, C3HC4 type family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HIP1

CGSNL Gene Name

HAL3-INTERACTING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

OsHIP1, HAF1, OsHAF1

Oryzabase Gene Name Synonym(s)

OsHAL3-interacting protein 1, Heading date Associated Factor 1

Transcript Evidence

AK067751 (DDBJ, Best hit)

Protein Evidence

B6SW07 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J013116L22 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0648800-02)

Others

Oryzabase (14741)

Transcript

2637 bp

>Os04t0648800-02 Similar to Zinc finger, C3HC4 type family protein.
GTCTTTCTCCTTCTCCTCCTCCTTCCTCTCGCTCTCTCCTCCTTGACAAAATTTCCTCCA
CCCATTCCCTTCTCCACCCACCCTGCCGATCTCTCTGAATTCGGTCGCCTCCTCCGCACC
ATCTTTCTCTCCTCCTCTCTTCTAGCAATCGGTCGTTTCCTCCGGTTGTTGTGCTGATTC
TTCGTTCTTTCTCTCCCTCTCTCTCTCTTTCTTTCTTCCTCTCTCTGCCTTGGAGAGGAT
CAAGAAACGAAGGGAGGGAGGAGAGGAGAGGAGAAGGGAAATCGAGAAAAGTCTGTTCTT
TGGTTTGGCTCGTGTGGTTCTTGAGAGCTGCTGTTTGGAAAATCTCTGCACCTGTTGCTG
ACCACTTGCTTCAATTGTTGAAAGAGATGAACAGCACCTGAGATGCTATTGCCAGACATC
AATTGATAAAGAGCACATCTTCAGTAATGCAAGGACAGAAGAACTCTGTTGAGCAGCTTG
CTGATGTGTTTGGATTTGACCATGCATCCAGTTCAGGAAACCCTGTCATGGATCAACAAG
GATATTGGAACAACATTCTTGGTTCAGTGGAGTCACATAACCTTCAAGGTTATCAGGTGA
ACCGTAGTGATGGAACTATTCCCTATGGAAACGGTGTGCATCAAAATGGCACTTTTTTAG
GTTTTTGGGAATCAGGCGAAGCAAGTGCAAGTGGCAGTTCACTACATTTTGGGGGCTCTA
ATGAGATCAAAGCTGAGCAACGTAATATCGGTGGTGGCCTAAGGATTGGTGAAAGGCGCT
TGGTAGCTGAGCGCAACCTTTCTTTGGATAATGTTGATATAGGCCTTAACATCAATGGTA
ATGATCTATCTGGTGAAAATTCAAATGTGAATGGTGCTTCACAAGGCTCTGAACTACATG
GTGGCTGCTCTCATACTGGTTCAAATGGTCAAGCCTCTGAGCTGAGATTACATCCATACA
GGACATTCATATTAGGTGCAGATCAACCTGAGCCTTTTAATTCTTTGAATGGCAGTGAAA
ATCCTTTAGGTGATTTTTCCTTGATGCCAGAAGGCATTGATCAGCGACCAGGCAGTTCCC
TGGATGGCCGCCGGCTGGCATGCAAGAGGAAAAATATAGAAGGAGTTAATGGGCAGTGCT
CGGCAGGTGCTAGCACTAGTTTTTCCCACAGGAACGATAGTATTTTCCATAACATTGCTT
CTTCGAGTCATAATCCCTCTCCTAGTACAAATTTACCCTCTCCTAATTGTCTGTTGGTTC
CAAGCACTCTTGATGAACAACTCCCGCGTTATGGAGCTACTACAGCTGGATTGTCATCTA
GTAGCTATGATCCTAGTGGAGGCAATAACAATTCAGGAGGCTCACAAAGAAGTTTTCGGC
CAAGAACTAGCCTGGCTCAACATATTGGCCCCTATGGTGTGTGGCCATCTTCAAGTACTA
TCAGACATTCCAGTGGTCAGTAGCCTGAACTTTCAATACCAGCATCCAATGAATGTCGTT
CCTGGCATTCCACAGATGTCACACCGGTTCACTGGTCCAGGGGCCTCATCATCAAGAACA
GGCAATTTGGAGAACAGAATTATTGGTAGTGAGGAATTTAGCGCGAGGAATGTAGTGGCT
ACCAGCTTCCCTGATGCAGTTCCTCCGGCCGCACTAGACATGAGGCATTTGATACCAGAA
CCATCTAGTTGGAATGTAGATGGCAGAGCTACTACCATTCCAGGAAATGTTCCTTCTTCA
TCGAGAGCTAATACCAATTCGATGGTTAATCCACCAGCAGGCTCTCCATTTATTGCCCAT
CAAAACTTGCATAGACGTAATCCTCGTAATTTGTCAGAGGAGATAAGTCGTTTATCTGGA
GCTCTTCGTGGCCATCAGCACCCACGCCTAAGGTCCGGTTTTCTGTTAGAACGACAAGGT
GATGGTGTTTGGGGTGTTCCGTTGTCAACTAGGAGCAGGGAAGGAAGAAGATTAATTGAG
ATCCGGAACGCGCTTGAAATGATTCACAGAGGGGAAAATGTAAGATTTGAGTCCATTTTC
TATGGTGGAGTCGACATTCATGACAGACACAGGGATATGCGCCTTGACATAGACAACATG
TCTTATGAGgagctattggcactggaagaaagaataggcaatgttagcactggcctcagt
gaggaagaagtgacaaaGCTCCTAAAGCAAAGGAAATTCTCATCATGGAGGTTGGAAGCA
TCTGTGGAAGAAGAGCCATGCTGTATCTGCCAGGAAGAGTATGTTGATGGGGATGATCTC
GGGACACTGGACTGTGGACATGACTTCCATGTTGGATGCGTCAGGCAATGGCTGGTTGTG
AAGAACACCTGTCCCATATGCAAAAATACTGCTCTGAAGTCTTAGAAAAAGCACAGGGCA
GTAAACACTGTGTGCTTGTTCGATCGCAAGATCGTTTAGTGATTCATATTACCGTGCCGT
TTTTTGATTAGAAATTTTTTTTGCCATTGACCTACAAATTTGATTAAAAAAAAAGGTAAA
AGAACTGGTCCCTGCAAACTGCCCCCTCCTGCAGTAAATAATCCCTGGAATCTGTCGCTC
TGCATTCAACTGAATATTTATGGCTGGTATATTGGATGATGGCTCAATATTTTTTTC

CDS

1017 bp

>Os04t0648800-02 Similar to Zinc finger, C3HC4 type family protein.
ATGCAAGGACAGAAGAACTCTGTTGAGCAGCTTGCTGATGTGTTTGGATTTGACCATGCA
TCCAGTTCAGGAAACCCTGTCATGGATCAACAAGGATATTGGAACAACATTCTTGGTTCA
GTGGAGTCACATAACCTTCAAGGTTATCAGGTGAACCGTAGTGATGGAACTATTCCCTAT
GGAAACGGTGTGCATCAAAATGGCACTTTTTTAGGTTTTTGGGAATCAGGCGAAGCAAGT
GCAAGTGGCAGTTCACTACATTTTGGGGGCTCTAATGAGATCAAAGCTGAGCAACGTAAT
ATCGGTGGTGGCCTAAGGATTGGTGAAAGGCGCTTGGTAGCTGAGCGCAACCTTTCTTTG
GATAATGTTGATATAGGCCTTAACATCAATGGTAATGATCTATCTGGTGAAAATTCAAAT
GTGAATGGTGCTTCACAAGGCTCTGAACTACATGGTGGCTGCTCTCATACTGGTTCAAAT
GGTCAAGCCTCTGAGCTGAGATTACATCCATACAGGACATTCATATTAGGTGCAGATCAA
CCTGAGCCTTTTAATTCTTTGAATGGCAGTGAAAATCCTTTAGGTGATTTTTCCTTGATG
CCAGAAGGCATTGATCAGCGACCAGGCAGTTCCCTGGATGGCCGCCGGCTGGCATGCAAG
AGGAAAAATATAGAAGGAGTTAATGGGCAGTGCTCGGCAGGTGCTAGCACTAGTTTTTCC
CACAGGAACGATAGTATTTTCCATAACATTGCTTCTTCGAGTCATAATCCCTCTCCTAGT
ACAAATTTACCCTCTCCTAATTGTCTGTTGGTTCCAAGCACTCTTGATGAACAACTCCCG
CGTTATGGAGCTACTACAGCTGGATTGTCATCTAGTAGCTATGATCCTAGTGGAGGCAAT
AACAATTCAGGAGGCTCACAAAGAAGTTTTCGGCCAAGAACTAGCCTGGCTCAACATATT
GGCCCCTATGGTGTGTGGCCATCTTCAAGTACTATCAGACATTCCAGTGGTCAGTAG

Protein

339 aa

>Os04t0648800-02 Similar to Zinc finger, C3HC4 type family protein.
MQGQKNSVEQLADVFGFDHASSSGNPVMDQQGYWNNILGSVESHNLQGYQVNRSDGTIPY
GNGVHQNGTFLGFWESGEASASGSSLHFGGSNEIKAEQRNIGGGLRIGERRLVAERNLSL
DNVDIGLNINGNDLSGENSNVNGASQGSELHGGCSHTGSNGQASELRLHPYRTFILGADQ
PEPFNSLNGSENPLGDFSLMPEGIDQRPGSSLDGRRLACKRKNIEGVNGQCSAGASTSFS
HRNDSIFHNIASSSHNPSPSTNLPSPNCLLVPSTLDEQLPRYGATTAGLSSSSYDPSGGN
NNSGGSQRSFRPRTSLAQHIGPYGVWPSSSTIRHSSGQ*

5'UTR

chr04:33022876..33023235 (+ strand) : 360 bp

chr04:33024324..33024409 (+ strand) : 86 bp

CDS

chr04:33024410..33025409 (+ strand) : 1000 bp

chr04:33025475..33025491 (+ strand) : 17 bp

3'UTR

chr04:33025492..33025867 (+ strand) : 376 bp

chr04:33025955..33026095 (+ strand) : 141 bp

chr04:33026698..33026748 (+ strand) : 51 bp

chr04:33027198..33027275 (+ strand) : 78 bp

chr04:33027349..33027492 (+ strand) : 144 bp

chr04:33027975..33028358 (+ strand) : 384 bp

FASTA

>Os04t0648800-02 class=Sequence position=chr04:33022876..33028358 (+ strand)
GTCTTTCTCC TTCTCCTCCT CCTTCCTCTC GCTCTCTCCT CCTTGACAAA ATTTCCTCCA CCCATTCCCT TCTCCACCCA
CCCTGCCGAT CTCTCTGAAT TCGGTCGCCT CCTCCGCACC ATCTTTCTCT CCTCCTCTCT TCTAGCAATC GGTCGTTTCC
TCCGGTTGTT GTGCTGATTC TTCGTTCTTT CTCTCCCTCT CTCTCTCTTT CTTTCTTCCT CTCTCTGCCT TGGAGAGGAT
CAAGAAACGA AGGGAGGGAG GAGAGGAGAG GAGAAGGGAA ATCGAGAAAA GTCTGTTCTT TGGTTTGGCT CGTGTGGTTC
TTGAGAGCTG CTGTTTGGAA AATCTCTGCA CCTGTTGCTG GTACGGTTTG CTGCATCTCT CTGTGTCTAT GTTTTTGTTT
AATTTCTCTT GTTCTTTTGA TTCTGCATGG TGGCCTGCCA TACTCTTTGG TTGGAAATCT ATGGTTCCTT TGCAATACAT
GTCCTTTCTT GTGTTGATTC TTTCGTGGTT CATCCCACGA GATGTTTTCT ACAGTCCGGA ATGTGTCAAA TGCTATTAAA
CCGTGAAAAA TTCGTGTTTT TCTTTTTCAT AAACACATTT CTTCAAACTT TGTAAACGGT ACGTTTCTCT TTGCTTGGTG
TTACGGTGAG AAACAGAGAT GACTTGGTGT TCTTGGTTGG TTAAATTCCT CCCTGTGTTG GTTGCCTTTC AATTTCGTCA
CGAGAAAATC AACCTGTCCC TTGAAACCGT GGATCGCCGC TTCTACCTTT TCTTTCCGTT TGTCTTTTTT ACTTAAAACT
TCTTTTTTTT TTGCAAACCG AAAAGGAAGG GAATTAAATG CAAATAAAAT GAGAGTAGTA GTAGTATATT TTTTGGATTG
TCCACAGAGG CAATGGGGCC CATCTTGCAT GCAGTCCATC TGTTTAGGTC GCATGCAATG TACAATCACC GTGTCTCACA
CTCATTAAAT TGCATGCATC AGCACAACCT TTGCTTACAA CAGCCCAAAC CATCAAGTTT GGTGCATCCA TATACCTCAC
CAAATGCGGT TCATGCCAAG ATTGCTACAG TAAAATTAGT TAATGCTCTC ATCAATGACA GAATGAATTG CTATTCTGTA
AAACCCAAAC TAGTCTTCCT GCTTCTGGAT AGTAACCCTT TTATCAAAAA GAATAACTTT CTGATAGCCG AGTCATGAAC
AAAAGATTTG TCTGTTCACA TTTCTATAGA TGTTAATTAG TTAAAGATAG TATATAACAA TAGGATTAGA CTTGCGTTGT
TCAGTAACAT AATGACTGAA ATTCAGCAGA ACCTAGCGTG TGATGAACCG TAGCATTCAA CATTCCTTCA ATTTGAGACT
GTTTGTTTGC TTCTTCTGTA CGGGCAATGC TAAGAACATA TTTTTTACCC AAAATTCTAA TATCTTACAA TCTTTCTTAC
ATTTGCAGAC CACTTGCTTC AATTGTTGAA AGAGATGAAC AGCACCTGAG ATGCTATTGC CAGACATCAA TTGATAAAGA
GCACATCTTC AGTAATGCAA GGACAGAAGA ACTCTGTTGA GCAGCTTGCT GATGTGTTTG GATTTGACCA TGCATCCAGT
TCAGGAAACC CTGTCATGGA TCAACAAGGA TATTGGAACA ACATTCTTGG TTCAGTGGAG TCACATAACC TTCAAGGTTA
TCAGGTGAAC CGTAGTGATG GAACTATTCC CTATGGAAAC GGTGTGCATC AAAATGGCAC TTTTTTAGGT TTTTGGGAAT
CAGGCGAAGC AAGTGCAAGT GGCAGTTCAC TACATTTTGG GGGCTCTAAT GAGATCAAAG CTGAGCAACG TAATATCGGT
GGTGGCCTAA GGATTGGTGA AAGGCGCTTG GTAGCTGAGC GCAACCTTTC TTTGGATAAT GTTGATATAG GCCTTAACAT
CAATGGTAAT GATCTATCTG GTGAAAATTC AAATGTGAAT GGTGCTTCAC AAGGCTCTGA ACTACATGGT GGCTGCTCTC
ATACTGGTTC AAATGGTCAA GCCTCTGAGC TGAGATTACA TCCATACAGG ACATTCATAT TAGGTGCAGA TCAACCTGAG
CCTTTTAATT CTTTGAATGG CAGTGAAAAT CCTTTAGGTG ATTTTTCCTT GATGCCAGAA GGCATTGATC AGCGACCAGG
CAGTTCCCTG GATGGCCGCC GGCTGGCATG CAAGAGGAAA AATATAGAAG GAGTTAATGG GCAGTGCTCG GCAGGTGCTA
GCACTAGTTT TTCCCACAGG AACGATAGTA TTTTCCATAA CATTGCTTCT TCGAGTCATA ATCCCTCTCC TAGTACAAAT
TTACCCTCTC CTAATTGTCT GTTGGTTCCA AGCACTCTTG ATGAACAACT CCCGCGTTAT GGAGCTACTA CAGCTGGATT
GTCATCTAGT AGCTATGATC CTAGTGGAGG CAATAACAAT TCAGGAGGCT CACAAAGAAG TTTTCGGCCA AGAACTAGCC
TGGCTCAACA TATTGGCCCC TATGGTGTGT GGCCATCTTC AAGTACTATC AGACATTCCA ATTCATGGAA TCATCAGCCA
CCTCCCTTTC AGAGTTCATT TGATGAACCA CCGGAGGTAA TTCCAGTGGT CAGTAGCCTG AACTTTCAAT ACCAGCATCC
AATGAATGTC GTTCCTGGCA TTCCACAGAT GTCACACCGG TTCACTGGTC CAGGGGCCTC ATCATCAAGA ACAGGCAATT
TGGAGAACAG AATTATTGGT AGTGAGGAAT TTAGCGCGAG GAATGTAGTG GCTACCAGCT TCCCTGATGC AGTTCCTCCG
GCCGCACTAG ACATGAGGCA TTTGATACCA GAACCATCTA GTTGGAATGT AGATGGCAGA GCTACTACCA TTCCAGGAAA
TGTTCCTTCT TCATCGAGAG CTAATACCAA TTCGATGGTT AATCCACCAG CAGGCTCTCC ATTTATTGCC CATCAAAACT
TGCATAGACG TAATCCTCGT AATTTGTCAG AGGTAGCTTT TCGCCTGCTC AGTTCAATAT GTTCCATTTT CAAATCGATT
TATCTTTTAG TAATCTTCTT GCGTTTTTTT CTTTTATAGG AGATAAGTCG TTTATCTGGA GCTCTTCGTG GCCATCAGCA
CCCACGCCTA AGGTCCGGTT TTCTGTTAGA ACGACAAGGT GATGGTGTTT GGGGTGTTCC GTTGTCAACT AGGAGCAGGG
AAGGAAGAAG ATTAATTGAG GTATCAATTC TGCTCTCTTT TTTTCCCTTC TCTTGCCTGC CTTGTTTCTG AACTAGGTCA
GAAATCAGAA TAATGTTATG TTTACATCCG TTTAGTGGAC ATACAGAAGC ATCATTAGGA ATAATATTCT GACGATCTTC
TAAATCTCAT TTCCCCTTTG ATCTCACATG CTTCTTCGCA TGTCTGCAGC CATCCACCTA ATTCTGCGGT GGAAAGATAA
ACTTTAGTTT CTCACCAATC TGAAAATGTT ACGGCAGTTG CTAAATTCCC CCCCCCCCTT ACGCACCATC ATCTTGTACC
TAGTAGTGAC ACTTAATTTT ATTAACTCAA CAGAGAGAGA GAGAGAGAGA GAGAGAGAGA GCACATATCT TGTTTTGGTT
TTAAATGACA CAGTGGATTA ATAGTTATAA AATTCAATGG ACCGTTTACC TTATGCATGC TACGTTTTGT TTCTAGCCGC
ATGTTATTCT CTAGAACTAT GTGGCTTGGA CAGGCAATAA CTAGTGAGCC ATCCATGTTG GATGCGTCGT TCATTTATTT
ACTTGTGTAA CCATGAAGTC TATGCAAGAC AATATGTTTC TTACCTTTTT GCTTGTCACC AGATCCGGAA CGCGCTTGAA
ATGATTCACA GAGGGGAAAA TGTAAGATTT GAGGTCAGTA ACAACTGTGG TTTCGGAGTT ACCTACAGTT GCCTATTTTT
ATCTGCACGG ACTTGTAGAG ATTGATGAAA CTATATTATG TCCTAAAAAC TCACAGCAAG ACTGGCTGAC TAATACTAGT
TGATGCTAGG ATTACATAAG GTTTGCTCTG TCCATTCAGT TTGGATGTAG AGGCTGGATT CTAATCCATT TTATAAAAGA
GAGATCGCAT AAGGTGTTGT TTTGTTTCTG AAAACAGAAG TTTCTTGTAA TATGGAAATA GTATATAGTG AATGCATGAA
AGACCATAGT ATATCTATAA TTCAGAAAAA TATAGTCATC ATTTCAACAG AGAGAAACAA ATAGGCAACA ACTTGCACTG
AACCCTTTTT TGTTTTCTAA AATCTTTGCT TATTTCTTGA GGTATTTACT CTTGCTTCCA CGTATATCTG TTCTTGCTAC
AGTCCATTTT CTATGGTGGA GTCGACATTC ATGACAGACA CAGGGATATG CGCCTTGACA TAGACAACAT GTCTTATGAG
GTTGGTTTTC CTTAGCACAA TATTATCTGG ATCTTTCTCC AGCAAAACTC TGATAATtgc tgttgtcttc caggagctat
tggcactgga agaaagaata ggcaatgtta gcactggcct cagtgaggaa gaagtgacaa aGCTCCTAAA GCAAAGGAAA
TTCTCATCAT GGAGGTTGGA AGCATCTGTG GAAGAAGAGC CATGCTGTAT CTGCCAGGTA TAACTCAGGC CTATCAGAAG
CTTGTGACAT AGTTTCCTTT GTTTAGTTAA CTTGAAATCT AGCAGGTTCA GTGCTTTGTG CATTTAGCTT TGTTAATTGT
ACGCCATACC TAATAGGTGA CATAAGCCTG TGAGTATGTC CATTTTAACT TGAAAAACAC TCATCTATCA ATAATGTAGC
TGTAATTATC AATTAAGTCG GTCAGGCCTG TGAACCACTA CCAGTTGGAC AACAATGCTC AACTTTTAAA ACTTGTAGCT
GAAAGTTGAA TATGATTTTG TTCAAGATTC CTAGTGCTGC ATATACTGAC CTACCCAAGC AAATATCTTA CCTTGGGATA
CACTTGAGGA ATTGTCTTTG CTCAATATCT TCCTTTTTCT TCATTGTCTT CTTAAATCAA TGAAAAGTTT TGGCAATTCT
GCAAACTAAT AATTCATATT GATGTCTTCT AACTATGTTC GTTCTCGCTG TTTATCCAGG AAGAGTATGT TGATGGGGAT
GATCTCGGGA CACTGGACTG TGGACATGAC TTCCATGTTG GATGCGTCAG GCAATGGCTG GTTGTGAAGA ACACCTGTCC
CATATGCAAA AATACTGCTC TGAAGTCTTA GAAAAAGCAC AGGGCAGTAA ACACTGTGTG CTTGTTCGAT CGCAAGATCG
TTTAGTGATT CATATTACCG TGCCGTTTTT TGATTAGAAA TTTTTTTTGC CATTGACCTA CAAATTTGAT TAAAAAAAAA
GGTAAAAGAA CTGGTCCCTG CAAACTGCCC CCTCCTGCAG TAAATAATCC CTGGAATCTG TCGCTCTGCA TTCAACTGAA
TATTTATGGC TGGTATATTG GATGATGGCT CAATATTTTT TTC

Locus: Os04g0648800

Loading...

Locus: Os04g0648800

Loading...