Os04t0649100-02

Locus

Os04g0649100

Description

Pathogenesis-related transcriptional factor and ERF domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SHAT1

CGSNL Gene Name

SHATTERING ABORTION 1

Oryzabase Gene Symbol Synonym(s)

SHAT1, AP2/EREBP#043, AP2/EREBP43, AP2-5, DLN124, OsDLN124

Oryzabase Gene Name Synonym(s)

SHATTERING ABORTION1, shattering abortion 1, APETALA2/ethylene-responsive element binding protein 43, APETALA2-5, DLN repressor 124, DLN motif protein 124

Transcript Evidence

AK121346 (DDBJ, Best hit)

Protein Evidence

Q25A26 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

Pathogenesis-related transcriptional factor/ERF, DNA-binding (IPR001471)

DNA-binding, integrase-type (IPR016177)

Full-length cDNA

J023121E19 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0649100-02)

RiceXPro (AK121346)

Others

Oryzabase (10404)

KEGG (Os04t0649100-02)

Transcript

1674 bp

>Os04t0649100-02 Pathogenesis-related transcriptional factor and ERF domain containing protein.
GTATGTCCTAATCGATCACCGTTTCTTCCTCTTTCGTTCGATCGTTCGTTCTTGGGCAAT
CTCCCGTAAATCATCTTGTGGGTTTTTGGTGCACTGCAGGTACGTCTACTTGGGGCTGTT
CGACACCGAGGAGGAAGCTGCCAGGGCGTACGACCGCGCTGCCATCAAGTGCAATGGCAA
GGATGCGGTGACGAACTTCGATCCAAGCATTTACGCCGGGGAGTTCGAGCCGCCGGGTGG
GTGTGTCATGTGTGCGCTTACTGCTCATGGCTAGGCTGTTCGTTTGTGAGTTGTGACTGC
TCATCCGGACAAAATCTGTCACTGTTTTGCAGCAGCGGCCACGGGTGATGCCGCCGAGCA
CAACCTGGACCTCTCGCTTGGGAGCTCGGCGGGCTCCAAGAGGGGCAACGTTGACGGTGG
CGGGGACGACGAGATCACCGGCGGCGGTGGCGGTGGCGCGGGCTCCGACCAGCGCGTCCC
TATGGCGTTCGACCTTGACTGGCAAACGGCGGCGGCGAGGAGCACCAAAGCTAAGTTCGA
CCAGAACTCGAACCATCCCCAGATGCCTCCGGTCCTGCAGGTCACCCACCTGCCATTCAG
TCCCAGGCATCATCACCAATTCTTGAGCAATGGTGATCCGGGGACAGCGGGAGGCCTGTC
ACTGACGATCGGCGCAGGCATGGCCGGGCACTGGCCTCCCCAGCAGCAGCAGGGGTGGGG
CAACGCCGGCGGCATGAGCTGGCCGCACCCGCCGCACCCGCCGCCGCCGCCGACCAACGC
CGCGGCCGCCGCAACCGCTACAGCAGCTGCAGCATCATCACGATTCCCTCCCTACATTGC
GACGCAAGCCTCAACCTGGCTGCAGAAGAACGGGTTCCATTCCCTGACCCGGCCCACCTA
AGATGATCAAAGATTTAAAATTCAAGATCGCTGCATTCATCGTCTCCTCGTCGATCGATC
ATGGCAAAGATCGATGGAGAGAGAGAGGTGTGTGTCACTGACGCAGGGAAAAACTCAATG
CAGATTTACCAGCAAGAACAAGAGCTGGATGCTATTCTTTTGCTCTACCTTTTTTCTTCT
CTCTTTCTTCTTCTCTGTTTCTTGATTGGGCGAGCGAGATGGAGATGGATCTGATCATGA
ATGGGACACAAGTGGGCATGTAAATGAGGAGCTCCCTAGAAGGCGAGAGAGATTGGCCAA
GCGTCGCCTCAAGCAGTGTAGGAGTATCTATCTTTTGCCGTTTCGCTCGCTTTCTTTCCT
TCTTTTCTTTCACCATGGCCAACAACGATGACTCTGGGTGTCAACATCACAGCTCATTTT
GTTCGGTCTCATGTTGCATCATTCACTGCATGATGACCATGATTCGGGAAAATTTGCTCC
ATGCACCTCCGCTTGGCCGACAACACTTGCCCTCTAGTAAGCATCCTTAAACACCCACGG
TTTCTACTACTATTCATCGCTTTATAAATCCTACGGAGTGCTAGCTTTACGCTACTACTA
CTGTCATGTAATCTATCATCATCAAAAGAGACGATCAGATTAACATATATGTCAACTATT
TAAGCTTTGGCTCTTTGCTTTCCAAGAAACGTAACTGCCGAGATGTGGAGCATATAGAAG
TATTCGTCCTTCTAGATGTTGGTACTAAAGTAATGTTCTTTCTTTTCTCCCTCT

CDS

273 bp

>Os04t0649100-02 Pathogenesis-related transcriptional factor and ERF domain containing protein.
TATGTCCTAATCGATCACCGTTTCTTCCTCTTTCGTTCGATCGTTCGTTCTTGGGCAATC
TCCCGTAAATCATCTTGTGGGTTTTTGGTGCACTGCAGGTACGTCTACTTGGGGCTGTTC
GACACCGAGGAGGAAGCTGCCAGGGCGTACGACCGCGCTGCCATCAAGTGCAATGGCAAG
GATGCGGTGACGAACTTCGATCCAAGCATTTACGCCGGGGAGTTCGAGCCGCCGGGTGGG
TGTGTCATGTGTGCGCTTACTGCTCATGGCTAG

Protein

91 aa

>Os04t0649100-02 Pathogenesis-related transcriptional factor and ERF domain containing protein.
YVLIDHRFFLFRSIVRSWAISRKSSCGFLVHCRYVYLGLFDTEEEAARAYDRAAIKCNGK
DAVTNFDPSIYAGEFEPPGGCVMCALTAHG*

5'UTR

chr04:33073342..33073342 (+ strand) : 1 bp

CDS

chr04:33073343..33073485 (+ strand) : 143 bp

chr04:33073632..33073761 (+ strand) : 130 bp

3'UTR

chr04:33073762..33074022 (+ strand) : 261 bp

chr04:33074118..33074201 (+ strand) : 84 bp

chr04:33074317..33075371 (+ strand) : 1055 bp

FASTA

>Os04t0649100-02 class=Sequence position=chr04:33073342..33075371 (+ strand)
GTATGTCCTA ATCGATCACC GTTTCTTCCT CTTTCGTTCG ATCGTTCGTT CTTGGGCAAT CTCCCGTAAA TCATCTTGTG
GGTTTTTGGT GCACTGCAGG TACGTCTACT TGGGGCTGTT CGACACCGAG GAGGAAGCTG CCAGGTAAAA TTATTGGGCC
GCACTGTGCG CGCGCGCGGC CATTGTTGTT GAATGTCGAG TGTGGCTGCT GCGCCGTTTG CGAGTTTACG CTTCTGGGTT
AGATGGGCGA GCGGTGATGG TGATTGATGT TTCTTGTCTC TTGGCCACAG GGCGTACGAC CGCGCTGCCA TCAAGTGCAA
TGGCAAGGAT GCGGTGACGA ACTTCGATCC AAGCATTTAC GCCGGGGAGT TCGAGCCGCC GGGTGGGTGT GTCATGTGTG
CGCTTACTGC TCATGGCTAG GCTGTTCGTT TGTGAGTTGT GACTGCTCAT CCGGACAAAA TCTGTCACTG TTTTGCAGCA
GCGGCCACGG GTGATGCCGC CGAGCACAAC CTGGACCTCT CGCTTGGGAG CTCGGCGGGC TCCAAGAGGG GCAACGTTGA
CGGTGGCGGG GACGACGAGA TCACCGGCGG CGGTGGCGGT GGCGCGGGCT CCGACCAGCG CGTCCCTATG GCGTTCGACC
TTGACTGGCA AACGGCGGCG GCGAGGAGCA CCAAAGCTAA GGTAAAAAAA GAATGGGGAC TTTGCTTTCC GCATCAGCCG
ATTGTCTTCT CATCACGTAA TAAAAAGGCT TAAAAATTCC TCGTTTTCTT GTCTAGTTCG ACCAGAACTC GAACCATCCC
CAGATGCCTC CGGTCCTGCA GGTCACCCAC CTGCCATTCA GTCCCAGGCA TCATCACCAA GTGGGTAGCT CACTATACAA
CTCCACTCCA CTTCGCTCCA TTTGCTGCTG AATTTCTCGC GTTTGGTTTC ACCGGTATCC GTGAGCTGAT GAATTCTTGA
TGTCTGTGCT GCTAGTTCTT GAGCAATGGT GATCCGGGGA CAGCGGGAGG CCTGTCACTG ACGATCGGCG CAGGCATGGC
CGGGCACTGG CCTCCCCAGC AGCAGCAGGG GTGGGGCAAC GCCGGCGGCA TGAGCTGGCC GCACCCGCCG CACCCGCCGC
CGCCGCCGAC CAACGCCGCG GCCGCCGCAA CCGCTACAGC AGCTGCAGCA TCATCACGAT TCCCTCCCTA CATTGCGACG
CAAGCCTCAA CCTGGCTGCA GAAGAACGGG TTCCATTCCC TGACCCGGCC CACCTAAGAT GATCAAAGAT TTAAAATTCA
AGATCGCTGC ATTCATCGTC TCCTCGTCGA TCGATCATGG CAAAGATCGA TGGAGAGAGA GAGGTGTGTG TCACTGACGC
AGGGAAAAAC TCAATGCAGA TTTACCAGCA AGAACAAGAG CTGGATGCTA TTCTTTTGCT CTACCTTTTT TCTTCTCTCT
TTCTTCTTCT CTGTTTCTTG ATTGGGCGAG CGAGATGGAG ATGGATCTGA TCATGAATGG GACACAAGTG GGCATGTAAA
TGAGGAGCTC CCTAGAAGGC GAGAGAGATT GGCCAAGCGT CGCCTCAAGC AGTGTAGGAG TATCTATCTT TTGCCGTTTC
GCTCGCTTTC TTTCCTTCTT TTCTTTCACC ATGGCCAACA ACGATGACTC TGGGTGTCAA CATCACAGCT CATTTTGTTC
GGTCTCATGT TGCATCATTC ACTGCATGAT GACCATGATT CGGGAAAATT TGCTCCATGC ACCTCCGCTT GGCCGACAAC
ACTTGCCCTC TAGTAAGCAT CCTTAAACAC CCACGGTTTC TACTACTATT CATCGCTTTA TAAATCCTAC GGAGTGCTAG
CTTTACGCTA CTACTACTGT CATGTAATCT ATCATCATCA AAAGAGACGA TCAGATTAAC ATATATGTCA ACTATTTAAG
CTTTGGCTCT TTGCTTTCCA AGAAACGTAA CTGCCGAGAT GTGGAGCATA TAGAAGTATT CGTCCTTCTA GATGTTGGTA
CTAAAGTAAT GTTCTTTCTT TTCTCCCTCT 

Locus: Os04g0649100

Loading...

Locus: Os04g0649100

Loading...