Os04t0653200-01

Locus

Os04g0653200

Description

Similar to Low affinity calcium transporter CAX2 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAX3

CGSNL Gene Name

Ca(2+)/H(+) EXCHANGER 3

Oryzabase Gene Symbol Synonym(s)

OsCAX3, CAX6, OsNCX9, OsNCX9.1, OsNCX9.2, NCX9

Oryzabase Gene Name Synonym(s)

Vacuolar cation/proton exchanger 3, Ca(2+)/H(+) exchanger 3, cation/H+ exchanger 3, Na+/Ca2+ Exchanger 9, Sodium/calcium exchanger 9

Transcript Evidence

AK073795 (DDBJ, Best hit)

Protein Evidence

Q6K1C4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cation transport (GO:0006812)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Molecular Function: cation transmembrane transporter activity (GO:0008324)

Functional domain (InterPro)

Calcium/proton exchanger (IPR004713)

Calcium/proton exchanger superfamily (IPR004798)

Sodium/calcium exchanger membrane region (IPR004837)

Full-length cDNA

J033068D06 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0653200-01)

RiceXPro (AK073795)

Others

Oryzabase (8983)

KEGG (Os04t0653200-01)

Transcript

1915 bp

>Os04t0653200-01 Similar to Low affinity calcium transporter CAX2 (Fragment).
gaggagtcgccaagacgtcgtaggcaacacctcccttcccccctacccttgaaccgaggc
cgagtcgtggtcgccgcgagtggaaggcaacaactctccaaggcaggcacaggcagcagc
agcaggaggagaggaggcaggcgcgggcggcgtgagcagcagcggcagcgccgcattaca
gccttgggagtaggaggaggaggaggcagcggatgatgatccctagggaaggggcggtgc
cggagcccgcggcggcgtcctgatccccgaccgacgatcgcggctgctgctgttgctatt
ttttcagaggatggagaatcctcagattgagatgggggccttcaaggcgaacggtccgca
attgcagaatggtgggctacgttccagcatggttcagtcctggaacctgcagagattcgt
tgagagcgcgctgcggagcatcaggattgtcatattcacttctaagctcaatctgctctt
gccgtttgggcctgcgtcgatcattctacactatactaccagcagacatggattggtctt
cctattcagcatgctaggaataacacctttagctgagcgcttgggttatgcaactgagca
gctcgcaatatacactggtccaacagttggggggcttctaaatgctacgttcggaaatgc
aactgaaatgatcatagcaatatatgctttgaaaaatggaatgatccgagtagttcaaca
atcattgcttggttccatattatcaaatatgttgttggttatgggctgtgctttctttgc
tggcggtattgttcatcggaacaaggaccaagtcttcagcaaggcaactgcagttgttaa
ctcaggtttactgttgatggctgtcatgggactaatgtttcctgctgtccttcacttcac
gcattcagaagtgaggcaaggagcatcagaggtttctctttcaaggttcagcagttgtat
tatgcttgtggcatatgcaagctatctctatttccaactaagtggacggaataatgctta
tagtccaattggcagtgaagaaatgcccaatgaggatgcagcagaggaagatgaagaatc
agagattggcatgtgggagtccatagcatggctcgcgatgttgacattatgggtgtctat
tctttctgaatacctggttaatgccattgagggggcatctgattcactgaacctacccgt
ggcttttatcagtgttattttgcttcctattgtgggaaacgctgctgaacatgctagtgc
aataatgtttgccatgaaagataaacttgacataacactgggtgttgcaattgggtcatc
aacgcagatatcaatgtttgtgattccattttgtgttgtcattggttggatgatggggca
aaagatggacttgaatttccaactattcgaaacagcaacgctcttcataacagtactagt
cgtggcatttatgctacaggatggtgttgcgaactacttgaaaggacttatgctgatctt
gtgttatctaatagttgccgccagtttcttcgttcacgttgatccacaatccagcgatga
ttgatgccacggacactgtaattattgtaccaaatacccttgaagcctttactaatctta
attctggtgagttgctcctccgtagcagagctcagcctgctggcaggagctggcagaatg
ttgacacggccgggaaaatcacgtggtgtcggttagtttgtccatgatctgcagcagcaa
ttattgcacgttgcaatagtcaaaagatctgaagggcatctaggaggaggggtggttgta
atgtatacagattacagaaacaaggaaatgcaatgcaatgtcgcccatgtaaaaagtctc
cttgcatagttgcattcaattaattcagttaatgtggccctggcccgttctctcc

CDS

1254 bp

>Os04t0653200-01 Similar to Low affinity calcium transporter CAX2 (Fragment).
atggagaatcctcagattgagatgggggccttcaaggcgaacggtccgcaattgcagaat
ggtgggctacgttccagcatggttcagtcctggaacctgcagagattcgttgagagcgcg
ctgcggagcatcaggattgtcatattcacttctaagctcaatctgctcttgccgtttggg
cctgcgtcgatcattctacactatactaccagcagacatggattggtcttcctattcagc
atgctaggaataacacctttagctgagcgcttgggttatgcaactgagcagctcgcaata
tacactggtccaacagttggggggcttctaaatgctacgttcggaaatgcaactgaaatg
atcatagcaatatatgctttgaaaaatggaatgatccgagtagttcaacaatcattgctt
ggttccatattatcaaatatgttgttggttatgggctgtgctttctttgctggcggtatt
gttcatcggaacaaggaccaagtcttcagcaaggcaactgcagttgttaactcaggttta
ctgttgatggctgtcatgggactaatgtttcctgctgtccttcacttcacgcattcagaa
gtgaggcaaggagcatcagaggtttctctttcaaggttcagcagttgtattatgcttgtg
gcatatgcaagctatctctatttccaactaagtggacggaataatgcttatagtccaatt
ggcagtgaagaaatgcccaatgaggatgcagcagaggaagatgaagaatcagagattggc
atgtgggagtccatagcatggctcgcgatgttgacattatgggtgtctattctttctgaa
tacctggttaatgccattgagggggcatctgattcactgaacctacccgtggcttttatc
agtgttattttgcttcctattgtgggaaacgctgctgaacatgctagtgcaataatgttt
gccatgaaagataaacttgacataacactgggtgttgcaattgggtcatcaacgcagata
tcaatgtttgtgattccattttgtgttgtcattggttggatgatggggcaaaagatggac
ttgaatttccaactattcgaaacagcaacgctcttcataacagtactagtcgtggcattt
atgctacaggatggtgttgcgaactacttgaaaggacttatgctgatcttgtgttatcta
atagttgccgccagtttcttcgttcacgttgatccacaatccagcgatgattga

Protein

418 aa

>Os04t0653200-01 Similar to Low affinity calcium transporter CAX2 (Fragment).
MENPQIEMGAFKANGPQLQNGGLRSSMVQSWNLQRFVESALRSIRIVIFTSKLNLLLPFG
PASIILHYTTSRHGLVFLFSMLGITPLAERLGYATEQLAIYTGPTVGGLLNATFGNATEM
IIAIYALKNGMIRVVQQSLLGSILSNMLLVMGCAFFAGGIVHRNKDQVFSKATAVVNSGL
LLMAVMGLMFPAVLHFTHSEVRQGASEVSLSRFSSCIMLVAYASYLYFQLSGRNNAYSPI
GSEEMPNEDAAEEDEESEIGMWESIAWLAMLTLWVSILSEYLVNAIEGASDSLNLPVAFI
SVILLPIVGNAAEHASAIMFAMKDKLDITLGVAIGSSTQISMFVIPFCVVIGWMMGQKMD
LNFQLFETATLFITVLVVAFMLQDGVANYLKGLMLILCYLIVAASFFVHVDPQSSDD*

5'UTR

chr04:33314700..33315006 (+ strand) : 307 bp

chr04:33315329..33315331 (+ strand) : 3 bp

CDS

chr04:33315332..33315550 (+ strand) : 219 bp

chr04:33315815..33315882 (+ strand) : 68 bp

chr04:33315953..33315981 (+ strand) : 29 bp

chr04:33316073..33316269 (+ strand) : 197 bp

chr04:33316347..33316559 (+ strand) : 213 bp

chr04:33316721..33316855 (+ strand) : 135 bp

chr04:33317222..33317338 (+ strand) : 117 bp

chr04:33317432..33317485 (+ strand) : 54 bp

chr04:33317674..33317790 (+ strand) : 117 bp

chr04:33318299..33318392 (+ strand) : 94 bp

chr04:33318675..33318685 (+ strand) : 11 bp

3'UTR

chr04:33318686..33319036 (+ strand) : 351 bp

FASTA

>Os04t0653200-01 class=Sequence position=chr04:33314700..33319036 (+ strand)
gaggagtcgc caagacgtcg taggcaacac ctcccttccc ccctaccctt gaaccgaggc cgagtcgtgg tcgccgcgag
tggaaggcaa caactctcca aggcaggcac aggcagcagc agcaggagga gaggaggcag gcgcgggcgg cgtgagcagc
agcggcagcg ccgcattaca gccttgggag taggaggagg aggaggcagc ggatgatgat ccctagggaa ggggcggtgc
cggagcccgc ggcggcgtcc tgatccccga ccgacgatcg cggctgctgc tgttgctatt ttttcaggtt ggttttggtg
ctattcgatt cggtttggtt attcacgagt tcttggattt ggggtagttt ggatttagga ttagtgggtg tagtgcttgc
tttggttagg tgcggcgtgg atctgggagg tcgatttagt atgctctagt ttggtatatg tgaattattc agcgcgattt
gagaatattg aagctgattt atgaacttga gcatatcata gagaaaggaa gggagcgaat ttgtggagaa agttgcttct
ttttcacact tagaatagtt ttatatactt ttaatcaact gattagactt cctgtggtgg tggttataga ggatggagaa
tcctcagatt gagatggggg ccttcaaggc gaacggtccg caattgcaga atggtgggct acgttccagc atggttcagt
cctggaacct gcagagattc gttgagagcg cgctgcggag catcaggatt gtcatattca cttctaagct caatctgctc
ttgccgtttg ggcctgcgtc gatcattcta cactatacta ccagcagaca tgtaagtcct gttcacagca actgaactct
attcgaccgc attttgttta tatttatcat tgttcgtagg ctagaaacca gagtacccta tcgagatgaa ctaataattg
ggctcactgc tctttagtaa cattactagt tttgtatttt ttgttaatgt ttcatcaatt gaagactatc tgatttagtc
aataggtttt tcttatgatg atctcttatt gctactcagt acttgtaact gatttctact ttaccaaaat tgcagggatt
ggtcttccta ttcagcatgc taggaataac acctttagct gagcgcttgg gttatgcaac tgagtgagtt agtgaactct
agacctattt ttttctgacc ttatttcgtt taacctaaac tactgttcta caggcagctc gcaatataca ctggtccaac
aggtatgcat ttttattttt atgatttata acctattaca aaatggagaa ccagtgaaca ataacagaca ttttctttta
ataccgattg cagttggggg gcttctaaat gctacgttcg gaaatgcaac tgaaatgatc atagcaatat atgctttgaa
aaatggaatg atccgagtag ttcaacaatc attgcttggt tccatattat caaatatgtt gttggttatg ggctgtgctt
tctttgctgg cggtattgtt catcggaaca aggaccaagt cttcagcaag gtaattttga tgcaacatgt tgtgcgtcct
ttccactcaa aagttcctga tatgaaatca atttttattt actacaggca actgcagttg ttaactcagg tttactgttg
atggctgtca tgggactaat gtttcctgct gtccttcact tcacgcattc agaagtgagg caaggagcat cagaggtttc
tctttcaagg ttcagcagtt gtattatgct tgtggcatat gcaagctatc tctatttcca actaagtgga cggaataatg
cttatagtcc aattggcagt gtaagtgtat acctcaattt aattcttcat tgatggtgac aaatatgata tgcttgcact
ttgaattgga acaacaagca atgaactaat ctccttgata acagtcagtt acattcccta aaaataaaaa tgtaatatcc
atgttccatc gcctgtcata ggaagaaatg cccaatgagg atgcagcaga ggaagatgaa gaatcagaga ttggcatgtg
ggagtccata gcatggctcg cgatgttgac attatgggtg tctattcttt ctgaatacct ggttaatgcc attgaggtat
tccttctctt ctaatttaga atgacagcac aaaaaaaaag tagctgttct taatatgtgc aactgacaaa tgattttttt
tggcctgtta aacttgacaa ttaactctat tttgtttata ttgggttact catatcaggg aaaatgtcca ccttaaattt
ggaaatgatt atttgatata tgataagaga tgtttacctc tttctgatga aagtccatga atattgcatc tctaatactg
tattttagga cagatttaac tgctctggcc atgttataca ttgtttgtct tacaggtcac ctgagtacct ctgcatgggt
atactattga tcactgcttt gctctttgct atttgctatc agggggcatc tgattcactg aacctacccg tggcttttat
cagtgttatt ttgcttccta ttgtgggaaa cgctgctgaa catgctagtg caataatgtt tgccatgaaa gataaacttg
taagcattta gatgtgctca gttttgatgt ttctttctga ttcttctgtt gtctcctaac tgtctgtgta catgattgtt
tctctgctgc aggacataac actgggtgtt gcaattgggt catcaacgca gatatcaatg tttgtggtaa tgcatggtca
aacttgttat ctcactatga tctgagtatg catttccgca cttgttcatc aaataccatg ctggcatgaa cgttctacag
aatactgtgt tcattccaga tcttgcattt gttcatttat catatcctat tttcatcttt gttatttttt acatatgtta
ttctccatat acagattcca ttttgtgttg tcattggttg gatgatgggg caaaagatgg acttgaattt ccaactattc
gaaacagcaa cgctcttcat aacagtacta gtcgtggcat ttatgctaca ggtaggttat tgtgtgaaat attaagaatt
attttgataa gggatgcctg cttaatgaag agtttgtcaa gctgtgtttg tttttgtatg ccttggcaca tataacccct
ccagagtaaa catgttctag cggagtagcg gtactaaacg attgttttaa cattattaag tatacagtca agtctttctc
aagcataatg gtcggtggtt gctattggtt agtgttgtaa tgttcatatt atccaatgaa caaatgctta ctctttaaag
gaactagaac tgacctactt tatgtaatac tttttacctt cagtagtggc tttaattatc ttgtcccacc tcgcttgtaa
tattagccca gtaaaccttc aatagtaata tgctgatcag gctttcttgt tatttcattt tcacactatc tgctatagct
ctcttatgaa ttacctggca taggttctga tatctcaacc atcaccagtt gatcacacgc tctttctatg tttccacagg
atggtgttgc gaactacttg aaaggactta tgctgatctt gtgttatcta atagttgccg ccagtttctt cgttcacgtt
gatccacaat ccagtaagta gagttacaga ctactttttc ttcatttcaa tgtcacaatc aaacttcatt aatttcatga
aaagagaaga actccgacat tgacagctta ctccatgcat gttttgtggt ggtcatatgt aagaaattgt tcttgccatg
gtttgatagt actagtagta gcatttggca tgtagttgaa atcaaccaat ggctatatta gatggttgat ctctggaagg
catatgagca gatatacgct gtgatcttaa gtgttgactc ccaatttttt tgcaggcgat gattgatgcc acggacactg
taattattgt accaaatacc cttgaagcct ttactaatct taattctggt gagttgctcc tccgtagcag agctcagcct
gctggcagga gctggcagaa tgttgacacg gccgggaaaa tcacgtggtg tcggttagtt tgtccatgat ctgcagcagc
aattattgca cgttgcaata gtcaaaagat ctgaagggca tctaggagga ggggtggttg taatgtatac agattacaga
aacaaggaaa tgcaatgcaa tgtcgcccat gtaaaaagtc tccttgcata gttgcattca attaattcag ttaatgtggc
cctggcccgt tctctcc

Locus: Os04g0653200

Loading...

Locus: Os04g0653200

Loading...