Os04t0660100-01

Locus

Os04g0660100

Description

Helix-loop-helix DNA-binding domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Os IBH1, OsIBH1, IBH1, OsbHLH175, bHLH175

Oryzabase Gene Name Synonym(s)

ILI1Binding bHLH Protein1, ILI1 Binding bHLH 1, basic helix-loop-helix protein 175

Transcript Evidence

AK109923 (DDBJ, Best hit)

Protein Evidence

Q01I07 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Helix-loop-helix DNA-binding (IPR011598)

Full-length cDNA

002-151-C02 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0660100-01)

RiceXPro (AK109923)

Others

Oryzabase (10951)

KEGG (Os04t0660100-01)

Transcript

1312 bp

>Os04t0660100-01 Helix-loop-helix DNA-binding domain containing protein.
GTGTCAGAGCCGTGTTCCTCGCTCTCTTCCCTTTCCTTTTTTTCTCTCTCTAAAATCGCA
ACCCACAAATCCTTCTGATCCGTTTGTGTCAGAGCCAAATCTTCTTCTTCTTCTCCATCT
CTCTCCTCTCCTCTTCTCTTCTCTCGTTGGAAGGTGAGGAGGTGAGGTGAGGTTGGGGGC
GCCGTTTGATGGACGCGAAGAGGACGCCGCCGCCGCCGACGCCGCCGAACCCTAACCCTA
GCGTAATTGGCAGCGGCGCCGCCGCGGACGGCGGCGGATTTGGGAGGGGGGAAGCGGCGG
CGGCGACGAAGCACATGCTGGCCTTCCACTTCCTGCGCGCGCTGTCGCGGATCCACCGGG
CGACACCCGTGACGCGGCGCACGCGGACCATCCGCCGGGCGGCCTACTCCTCCATGGCGC
GGGCGGCGAGCCCGCGCCGCGCGTGGAGCCGGGCGCTGCTCGGCCAGGTCCGCGCGCGGA
GGTCCAGGACGCTGATGAGGCGCGCCGCCGTGCTGGTGCGGAGGCGCGTCGTAGCCGCTC
CTGCGCCTTCTCCCGCCTCCGCCAGAGGCGTCAGGATTATTGCTGCCGGAGAGACGTCGG
CGGCGGCTCGGGCTGTTCCGCCGCCTCCGCGGCAGCAGGGCGAGCCGCCGAGGGCCGAAG
CGCTCCGGCGCCTGGTCCCCGGCGGCGCCGGCATGGAGTACTCCAGCCTCCTGGAGGAGA
CCGCCGACTACCTCCGCTCGCTTCGCGCGCAGGTGCAGCTGATGCAAGGCCTCGTCGACC
TCTTCTCCTACCAATGATCCATCCATCGAGTAATTAACATATGCATCATATGGTTAATTA
TTTATTCGTTCGTCTTGCACGCATCACATGCTGCTGTTGCTGCTTCTGTTCTACTTCTCT
ACCTACATCATATCGATCTATCTCTTGTTCATGTGGATCGATCGATCGATGCATATGATG
GTTGGTTAAGATAGGGGATTATTATTGGGGTAATTAAGGGGAGGATCTAGGAGATTGGGT
GGAGTGTTAGTATACATGTTTTTTGTTTTTGTTGGTAATTAAGATTATTGGTAGGTGATG
AAAAGATTGTTGGATACATACATCCATGTATAGAAGTATAGGCCGACCGGCTGGGAGCAC
AATGAATTGAATCATATATACCAAGAAGAAGGCTTTATAGAGAGAGAGAGAGAGAGGGGT
AATTAATTGTAACATATAAAGAGAAGGATGAAGTTACATATACTATATGATAGTGAATTA
GTGCAGTGTTAATTGTTGTCAATTGTCAGTAAATCGATCTATATATCTGCGT

CDS

609 bp

>Os04t0660100-01 Helix-loop-helix DNA-binding domain containing protein.
ATGGACGCGAAGAGGACGCCGCCGCCGCCGACGCCGCCGAACCCTAACCCTAGCGTAATT
GGCAGCGGCGCCGCCGCGGACGGCGGCGGATTTGGGAGGGGGGAAGCGGCGGCGGCGACG
AAGCACATGCTGGCCTTCCACTTCCTGCGCGCGCTGTCGCGGATCCACCGGGCGACACCC
GTGACGCGGCGCACGCGGACCATCCGCCGGGCGGCCTACTCCTCCATGGCGCGGGCGGCG
AGCCCGCGCCGCGCGTGGAGCCGGGCGCTGCTCGGCCAGGTCCGCGCGCGGAGGTCCAGG
ACGCTGATGAGGCGCGCCGCCGTGCTGGTGCGGAGGCGCGTCGTAGCCGCTCCTGCGCCT
TCTCCCGCCTCCGCCAGAGGCGTCAGGATTATTGCTGCCGGAGAGACGTCGGCGGCGGCT
CGGGCTGTTCCGCCGCCTCCGCGGCAGCAGGGCGAGCCGCCGAGGGCCGAAGCGCTCCGG
CGCCTGGTCCCCGGCGGCGCCGGCATGGAGTACTCCAGCCTCCTGGAGGAGACCGCCGAC
TACCTCCGCTCGCTTCGCGCGCAGGTGCAGCTGATGCAAGGCCTCGTCGACCTCTTCTCC
TACCAATGA

Protein

203 aa

>Os04t0660100-01 Helix-loop-helix DNA-binding domain containing protein.
MDAKRTPPPPTPPNPNPSVIGSGAAADGGGFGRGEAAAATKHMLAFHFLRALSRIHRATP
VTRRTRTIRRAAYSSMARAASPRRAWSRALLGQVRARRSRTLMRRAAVLVRRRVVAAPAP
SPASARGVRIIAAGETSAAARAVPPPPRQQGEPPRAEALRRLVPGGAGMEYSSLLEETAD
YLRSLRAQVQLMQGLVDLFSYQ*

5'UTR

chr04:33683353..33683540 (- strand) : 188 bp

CDS

chr04:33682744..33683352 (- strand) : 609 bp

3'UTR

chr04:33682229..33682743 (- strand) : 515 bp

FASTA

>Os04t0660100-01 class=Sequence position=chr04:33682229..33683540 (- strand)
GTGTCAGAGC CGTGTTCCTC GCTCTCTTCC CTTTCCTTTT TTTCTCTCTC TAAAATCGCA ACCCACAAAT CCTTCTGATC
CGTTTGTGTC AGAGCCAAAT CTTCTTCTTC TTCTCCATCT CTCTCCTCTC CTCTTCTCTT CTCTCGTTGG AAGGTGAGGA
GGTGAGGTGA GGTTGGGGGC GCCGTTTGAT GGACGCGAAG AGGACGCCGC CGCCGCCGAC GCCGCCGAAC CCTAACCCTA
GCGTAATTGG CAGCGGCGCC GCCGCGGACG GCGGCGGATT TGGGAGGGGG GAAGCGGCGG CGGCGACGAA GCACATGCTG
GCCTTCCACT TCCTGCGCGC GCTGTCGCGG ATCCACCGGG CGACACCCGT GACGCGGCGC ACGCGGACCA TCCGCCGGGC
GGCCTACTCC TCCATGGCGC GGGCGGCGAG CCCGCGCCGC GCGTGGAGCC GGGCGCTGCT CGGCCAGGTC CGCGCGCGGA
GGTCCAGGAC GCTGATGAGG CGCGCCGCCG TGCTGGTGCG GAGGCGCGTC GTAGCCGCTC CTGCGCCTTC TCCCGCCTCC
GCCAGAGGCG TCAGGATTAT TGCTGCCGGA GAGACGTCGG CGGCGGCTCG GGCTGTTCCG CCGCCTCCGC GGCAGCAGGG
CGAGCCGCCG AGGGCCGAAG CGCTCCGGCG CCTGGTCCCC GGCGGCGCCG GCATGGAGTA CTCCAGCCTC CTGGAGGAGA
CCGCCGACTA CCTCCGCTCG CTTCGCGCGC AGGTGCAGCT GATGCAAGGC CTCGTCGACC TCTTCTCCTA CCAATGATCC
ATCCATCGAG TAATTAACAT ATGCATCATA TGGTTAATTA TTTATTCGTT CGTCTTGCAC GCATCACATG CTGCTGTTGC
TGCTTCTGTT CTACTTCTCT ACCTACATCA TATCGATCTA TCTCTTGTTC ATGTGGATCG ATCGATCGAT GCATATGATG
GTTGGTTAAG ATAGGGGATT ATTATTGGGG TAATTAAGGG GAGGATCTAG GAGATTGGGT GGAGTGTTAG TATACATGTT
TTTTGTTTTT GTTGGTAATT AAGATTATTG GTAGGTGATG AAAAGATTGT TGGATACATA CATCCATGTA TAGAAGTATA
GGCCGACCGG CTGGGAGCAC AATGAATTGA ATCATATATA CCAAGAAGAA GGCTTTATAG AGAGAGAGAG AGAGAGGGGT
AATTAATTGT AACATATAAA GAGAAGGATG AAGTTACATA TACTATATGA TAGTGAATTA GTGCAGTGTT AATTGTTGTC
AATTGTCAGT AAATCGATCT ATATATCTGC GT

Locus: Os04g0660100

Loading...

Locus: Os04g0660100

Loading...