Os04t0660100-02

Locus

Os04g0660100

Description

Similar to H0112G12.1 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Os IBH1, OsIBH1, IBH1, OsbHLH175, bHLH175

Oryzabase Gene Name Synonym(s)

ILI1Binding bHLH Protein1, ILI1 Binding bHLH 1, basic helix-loop-helix protein 175

Transcript Evidence

AK288609 (DDBJ, Best hit)

Protein Evidence

Q01I07 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Helix-loop-helix DNA-binding (IPR011598)

Full-length cDNA

J090053H14 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0660100-02)

Others

Oryzabase (10951)

KEGG (Os04t0660100-02)

Transcript

5845 bp

>Os04t0660100-02 Similar to H0112G12.1 protein.
GGCGGATTTGGGAGGGGGGAAGCGGCGGCGGCGACGAAGCACATGCTGGCCTTCCACTTC
CTGCGCGCGCTGTCGCGGATCCACCGGGCGACACCCGTGACGCGGCGCACGCGGACCATC
CGCCGGGCGGCCTACTCCTCCATGGCGCGGGCGGCGAGCCCGCGCCGCGCGTGGAGCCGG
GCGCTGCTCGGCCAGGTCCGCGCGCGGAGGTCCAGGACGCTGATGAGGCGCGCCGCCGTG
CTGGTGCGGAGGCGCGTCGTAGCCGCTCCTGCGCCTTCTCCCGCCTCCGCCAGAGGCGTC
AGGATTATTGCTGCCGGAGAGACGTCGGCGGCGGCTCGGGCTGTTCCGCCGCCTCCGCGG
CAGCAGGGCGAGCCGCCGAGGGCCGAAGCGCTCCGGCGCCTGGTCCCCGGCGGCGCCGGC
ATGGAGTACTCCAGCCTCCTGGAGGAGACCGCCGACTACCTCCGCTCGCTTCGCGCGCAG
GTGCAGCTGATGCAAGGCCTCGTCGACCTCTTCTCCTACCAATGATCCATCCATCGAGTA
CGTCTTCTATCTGATTGGGGAAGAAACAGGTAATTACTTAATCAAAGAACTTAACAATGA
GGTCATAGATGAATGGATGTTGCATATATATCATGCATGATAATCTGCATGTGTGCAGAT
TCGTTTTGTTCTAGTAGAATTAAGTATTAATTGGTTGCTAGCTAGCTGCACATGCATGAT
GCATATGTGTGTACTACCTCTATATCATCGTTCCCATGCATCCGCTACTCGTATTAGCTA
GGGATTGACAGCTAGATGATGCTCCATTAGCTAGTTGTTGCCTAGCTTGTCTAATTAGAC
TATTAGAGTACTGCTAGCTTGCTAACTAGGAGGGTGGTTATGTTGAATTGGTTGTTTGGT
AGAGTGTTTTTTCTTTTCTCCTCTCTCAAATTTGGGAAAGTGGGAGCCACAATCTATGAG
GGATAGGGTTGCTAATCTTTGAGCTTGATGAGAAGACACACATAACTTGTGGCCAAAGGA
ACCAAACAAAAGACATTCTCTCCATGGGCGGTTAGCATCTTTTGATTAAAGGGCCTTGTG
TTTTTCCCTTTGGAAATAAGCATATATGTATTTGTGTTTTTGCTATTATTTTTCTTCTCT
CTTCTTGTTGCCCTTCCATCATCTCTCTCTACCAACTTATCCCTGTTCCTTTTTAGGTGC
CACCGGTTCTCTATTGAGTATTCTTTGTGTACTTGATGCTGCTGGCAAGTTTTTCTGCTT
GGCTCTTTTGTCGTGTTTTTTTTTCTCTCAGTTGGCTAGCTTTGACACATGCGTTTGTTG
CTTCCTTTATGGGGTAAGAATCCGAAAGGGTTGAAGCTAGCCTCTTCTGCTTGTAAGCTT
CCTATTAAGTGTTATGTTACATCGGGATCATATATATATGTACAACACAAACAGTAGTTA
ATCAACTGGACGTAGAAAAAGACTAGCTGGTACCATGCAAGTTTGACATGCATGGTTGAA
ACCACATTCTTTACTTTTACTTAACTGATATAATAATATAGTTAAGTCTTTTGCATGTCC
CTGAAAAAAAAAGGTAAAAAGATACAGACGAAGCAGATGCAAAGAATCTTAGTAGAACTA
TATGTATTTACATATGTGTGTTTTCACACTAGCTAGCTAACAGATTATGTCTTGTGCACC
GTGGTATATTGAGAGAAGAAGAGCCTGCTGCCTGCTGCATCCATAAAATACCCTAAATTT
CTGCTTTTGCTTTTTTAATTTTTTTATTTGTACTTGCATATATTGTTTTTAGTTGTGATC
ACAGAGCTAGATATAATTTCCACTTAAGACGATATTGTAGTGTGTGGTTTTAATCTGTTT
TCTATTTGGATATTCGATAGGGGGGCGTTTTTGGTTCAGATATCGAATTTGCTCATTGGC
CATAGCTAGCTGTCATATATGACAAAATTAGTACACCTATTGACAGGACAAAGCTAGCTA
CATGCATGTGTGCATTTTGCTTGGAATCATGTAAGATCACCATCCAATTCGCAATTGGGC
CACAAAATAGCTATATTAGGGAGCCATTTCACATCACTAAAAACATTTTTGGTACTTGAA
TCAACAGCTAATCATAATTGGCCCACTGATTAGCTGTACTCATTTGATCAGCTGGCTATA
ATCATCTCCTTCAACAGACATGCATGTATATATGCTATATAGTACTATACCTTGGAATGT
ACATATTGAAATAAAATAAACATGGATCGGTGTGTAGCGTATCATATATGCATCGAGACA
CATATTTGTGACAGTACATCGGAATTTTCTAACATCATGCATGTTTAATTACTGCATATA
TGACTTTCTGTCACTTCTATTTTTCAGAATACTATCTTTGATCATCTGCTGGTTAGCCTT
GCCATTAGTTCATATATAGACTTATATATAATTTTGTTTTCAATGTTAATGCACTAAAAA
TTGTGCTCCATTCGAACAAAATGCAGAGAAATTAAAAGATGATTCAGATTGGTCCAAAAT
ACATATATATAGTTAGCATGGTCAAGTAATTTAATGAGTTTGCCGATTTGATATATCAGT
TTTTTATTTCGTCAAATACACGATGATATATATAGGTGCATGAAATAATTCTCAGTATTG
CTAATTGATCGTTATTTCAGCAGGATGTGAAATTAGTTAATAATTGCCGCTATATATACC
TGTCATATCTTCGTATTAGGACTTATCCACATGGACACATCCATTTTATGTCACTGAAAG
CTCACTATACTTCTTAATTTTTAATATGCTTGCTTATAATTTATCTATTAGCGGGAGAAG
CATCAATGATATACGATGGAATAATAAATTAATGCATGATATTTTATCCATCATGATTAA
AATACAGTGCGATAGCGCCCATGAATATTACGATACACGAGTATATATGCTTTTAATAAG
ATTTTAGTGAAGCTAGTGAGTTACAATCGCTACTATAGCTTCATCTCTTTGAGCATATGT
TAGGGAACATATTTAGAGATGAGTAAGTGTGGTGTGCCGCACGCGTAAGAGTACTTTGTG
AAATCGGAAAAATTAATCTTTATTAACAGACCGTGCGTGGGACATATTTTAGGCCGTGTG
AGTATTGTGGTAATCGAAAAAAATATTGTTAATAAACCATGTGCACGAGATAGATGGATG
TACTAGTTAATGGGGGTACTAGTTATTTTAACAAGTAGTGCTGTTGCATATCAAATATGC
ACATTTAATTTCTCTCTTATATATACAGCATATATATGTATCCGGGATAAATATGCCGTG
CAAATTAAATTGATTTTTGTGCCATCAGCTATATATTCTTATGCACGGAATGCAGATATA
TAGAAAATTCAGTACATGGCTTTCTTTATACCGTGGCTAACGTACGTATACGCATCCATA
TGCATGGATCCGTATATATGCCTCCAGGGACTTTTGTATGTGTATCGCCTCGTACTCTCT
GTTGTTTGAATGTTTTTGTAGATCTAGCGATCAATGTGTTTAATTAATTAACCGAACGCT
ACCAACAGTACTACACCACTTATACAGCACCTGCTGACTTTAATTTAAAGTATATATACT
TTTTGAGATTTAACCAAGTTATAGTTGATGAATGTTACGTGCTACACAGCGCTTGTGCTT
TAATTAGATCGACCAAACCTAGCTGGCTAGCTAGCGTATTACTCTAATTAATATACTCGA
TCGGTATATATATAAGAGCTTAGCATGCGTGGAACAGTACGGTACAAATTAATTTTGTGT
CATTTTGACTCATTGTGTGTGTGTAAGTCTGTATAGAATTGTTCATTGTGTATAATTAAG
CTTGTATACAATTAATTAATTGTGCAATTATATATATTGTGTGTAAGATTATAACATGGG
AAAGCTGTTCGTGTATGCACCATGTATGCGTGTAAGCTAACGAGGATATATTGCGGCCGA
TGGATACATGGCACCTATCCCTAAAATTCATTTTTTTAATTAGTCCCTTTTACTGTCCTT
TCCTGCTGCTTAATTGAGCCCATATATATTAATCTACTCTGGCATCAATATAGAAGAAAC
GAGAAGAAGTCTAAGGCCCATTCCATTATTTGTACTGAGAGCTGCAGAATTTGTAAGAAC
TTTGGTATACGAAATATTCCCACTAATTTGAATGTTGGTTTTCCTACAAAATTCTCGATA
CACTAGAGTGAAGTGCTCAAGACAACAAACATGAATTGGAGTGCGTGTAGTGGTTAGCTA
GCTAATTATAATTAATCTTTGATTAATGATATAGATATAGTAAAGGGAAACATatatcct
atgcacacaaactttccgtgcataccaactaataaatatcatgaaaaattatagaaaaaa
ttggatatttattcataatagtCGAGATGATGCAGTACATATATATCCTATCTGTTTCTA
ATTAACATTAACACGAGATTTATGGCGAGGGGCAGCAGAAAATTACTCAGAATTAAATAA
CAACCTTTTCTGTCTTAGCAAGTAGTAGCAACGTCAGACTGACGTCGTTGCATAAATATA
TGTACAGTTGTCTCCAACTACAAGGACGTACAGACTGACGCTACGGAGATATGTCGAATA
CGTCATAAGTTAGGACCATGTCCAAAGCATGCATGACATTGTTGTTGTTTTCCTGAAATA
TTTGGAAATTATATATTCAGAAGACTTAGCTATATATATACACGCATATATATAATAATT
AATTAAATAGCTACTAGCTAGTAGGTGCGAGTACCACGCGCGTACGTACGTACACCTCTC
TAGCTAGCTGTATTCCTGTACGTATTTAGTGTATGGTACAGGGACATGATCAGTACAGAT
TATATATTATTCATGGTAACGTGTAACCTTGTATGCCATATGGACGTATTATGCATATAA
TGTGACTGATTCAATTGGTGCAAATGCATGGCTACTAAGCAAGCTTCCCCTGCTCTAGAA
TTATTGATTAGTTAACAAATTTTGTCGGTTCAATTCCAACCTGGTCATATCATAAGTACA
GGTTCTGTTAGTTCTTCCCTTGCATCTTGACGAACACTCTCAATTTAATTTCTTGAATCT
TGACGAGTAGTCCGTCAAAATCTTAAATCATAGCTATAGAGACTACCGTCCTGGTAAGAA
TTCATTAATTACATCGATGAATGTCTGGCAGTACTTAATTTACCAGAAAACTGGTGAATT
AATCAGCCATCGATGATCGTTGCCTGTTGCCACAATCTGTTGATTGATTTTTTTTCCCCT
ACTTCCATCGTCAAAACGATCAATTATTAGTCTTGCGCAACACCAAGTTGAACTCCGTAC
ATCATCAGACGATGCTATGTTGTTTAATTTGCATATCGTCGGAGCTCTGAACTCATGAAC
TTAAGTACGTGGATACACTATCATCATTCTACCTACACCGCCTTCTGTAGAAAATTATAC
GGGAGTTTTTCTAATTTATATGGAATTTAACTGTTTACCGCAGCTGTAAATTAAATTCCT
AATTCCTGTACAACAGTACAAGAAGACTGATCATATATCCAATATCCATGATTTTTTAGT
AGATATAGTCGGTCCTTCCATAGTTATGTGGTTTAATTTGTTTACTATGATCTAACTAGT
TTAGATATCCTCAAGTTGTTTTCCACTTTATCCACACTTTCAATCAAAACCATGCGCGCT
TAATGCCTTTATAAACATTATAAACACGGCGAGAAGAGATTGAAATGTCCTGACGTCGCA
TAGATCGAAAGCTAGTTAATTAATTAAGCTAATTAATTAGACGTCCAGCTGAAAGCCTGA
AAGCTAAAGCTCGAAATCATACACG

CDS

525 bp

>Os04t0660100-02 Similar to H0112G12.1 protein.
GGCGGATTTGGGAGGGGGGAAGCGGCGGCGGCGACGAAGCACATGCTGGCCTTCCACTTC
CTGCGCGCGCTGTCGCGGATCCACCGGGCGACACCCGTGACGCGGCGCACGCGGACCATC
CGCCGGGCGGCCTACTCCTCCATGGCGCGGGCGGCGAGCCCGCGCCGCGCGTGGAGCCGG
GCGCTGCTCGGCCAGGTCCGCGCGCGGAGGTCCAGGACGCTGATGAGGCGCGCCGCCGTG
CTGGTGCGGAGGCGCGTCGTAGCCGCTCCTGCGCCTTCTCCCGCCTCCGCCAGAGGCGTC
AGGATTATTGCTGCCGGAGAGACGTCGGCGGCGGCTCGGGCTGTTCCGCCGCCTCCGCGG
CAGCAGGGCGAGCCGCCGAGGGCCGAAGCGCTCCGGCGCCTGGTCCCCGGCGGCGCCGGC
ATGGAGTACTCCAGCCTCCTGGAGGAGACCGCCGACTACCTCCGCTCGCTTCGCGCGCAG
GTGCAGCTGATGCAAGGCCTCGTCGACCTCTTCTCCTACCAATGA

Protein

175 aa

>Os04t0660100-02 Similar to H0112G12.1 protein.
GGFGRGEAAAATKHMLAFHFLRALSRIHRATPVTRRTRTIRRAAYSSMARAASPRRAWSR
ALLGQVRARRSRTLMRRAAVLVRRRVVAAPAPSPASARGVRIIAAGETSAAARAVPPPPR
QQGEPPRAEALRRLVPGGAGMEYSSLLEETADYLRSLRAQVQLMQGLVDLFSYQ*

CDS

chr04:33682744..33683268 (- strand) : 525 bp

3'UTR

chr04:33682732..33682743 (- strand) : 12 bp

chr04:33676818..33682125 (- strand) : 5308 bp

FASTA

>Os04t0660100-02 class=Sequence position=chr04:33676818..33683268 (- strand)
GGCGGATTTG GGAGGGGGGA AGCGGCGGCG GCGACGAAGC ACATGCTGGC CTTCCACTTC CTGCGCGCGC TGTCGCGGAT
CCACCGGGCG ACACCCGTGA CGCGGCGCAC GCGGACCATC CGCCGGGCGG CCTACTCCTC CATGGCGCGG GCGGCGAGCC
CGCGCCGCGC GTGGAGCCGG GCGCTGCTCG GCCAGGTCCG CGCGCGGAGG TCCAGGACGC TGATGAGGCG CGCCGCCGTG
CTGGTGCGGA GGCGCGTCGT AGCCGCTCCT GCGCCTTCTC CCGCCTCCGC CAGAGGCGTC AGGATTATTG CTGCCGGAGA
GACGTCGGCG GCGGCTCGGG CTGTTCCGCC GCCTCCGCGG CAGCAGGGCG AGCCGCCGAG GGCCGAAGCG CTCCGGCGCC
TGGTCCCCGG CGGCGCCGGC ATGGAGTACT CCAGCCTCCT GGAGGAGACC GCCGACTACC TCCGCTCGCT TCGCGCGCAG
GTGCAGCTGA TGCAAGGCCT CGTCGACCTC TTCTCCTACC AATGATCCAT CCATCGAGTA ATTAACATAT GCATCATATG
GTTAATTATT TATTCGTTCG TCTTGCACGC ATCACATGCT GCTGTTGCTG CTTCTGTTCT ACTTCTCTAC CTACATCATA
TCGATCTATC TCTTGTTCAT GTGGATCGAT CGATCGATGC ATATGATGGT TGGTTAAGAT AGGGGATTAT TATTGGGGTA
ATTAAGGGGA GGATCTAGGA GATTGGGTGG AGTGTTAGTA TACATGTTTT TTGTTTTTGT TGGTAATTAA GATTATTGGT
AGGTGATGAA AAGATTGTTG GATACATACA TCCATGTATA GAAGTATAGG CCGACCGGCT GGGAGCACAA TGAATTGAAT
CATATATACC AAGAAGAAGG CTTTATAGAG AGAGAGAGAG AGAGGGGTAA TTAATTGTAA CATATAAAGA GAAGGATGAA
GTTACATATA CTATATGATA GTGAATTAGT GCAGTGTTAA TTGTTGTCAA TTGTCAGTAA ATCGATCTAT ATATCTGCGT
ATATGTGTGT TTGTGAATTG TGAAAAATTC ATGCATCCTA CTAACCTACC TTTGTAGCTG TATCTGCGAT GTTGGTATAT
ATATATTTTT TCATCTTCTG TAGGTACGTC TTCTATCTGA TTGGGGAAGA AACAGGTAAT TACTTAATCA AAGAACTTAA
CAATGAGGTC ATAGATGAAT GGATGTTGCA TATATATCAT GCATGATAAT CTGCATGTGT GCAGATTCGT TTTGTTCTAG
TAGAATTAAG TATTAATTGG TTGCTAGCTA GCTGCACATG CATGATGCAT ATGTGTGTAC TACCTCTATA TCATCGTTCC
CATGCATCCG CTACTCGTAT TAGCTAGGGA TTGACAGCTA GATGATGCTC CATTAGCTAG TTGTTGCCTA GCTTGTCTAA
TTAGACTATT AGAGTACTGC TAGCTTGCTA ACTAGGAGGG TGGTTATGTT GAATTGGTTG TTTGGTAGAG TGTTTTTTCT
TTTCTCCTCT CTCAAATTTG GGAAAGTGGG AGCCACAATC TATGAGGGAT AGGGTTGCTA ATCTTTGAGC TTGATGAGAA
GACACACATA ACTTGTGGCC AAAGGAACCA AACAAAAGAC ATTCTCTCCA TGGGCGGTTA GCATCTTTTG ATTAAAGGGC
CTTGTGTTTT TCCCTTTGGA AATAAGCATA TATGTATTTG TGTTTTTGCT ATTATTTTTC TTCTCTCTTC TTGTTGCCCT
TCCATCATCT CTCTCTACCA ACTTATCCCT GTTCCTTTTT AGGTGCCACC GGTTCTCTAT TGAGTATTCT TTGTGTACTT
GATGCTGCTG GCAAGTTTTT CTGCTTGGCT CTTTTGTCGT GTTTTTTTTT CTCTCAGTTG GCTAGCTTTG ACACATGCGT
TTGTTGCTTC CTTTATGGGG TAAGAATCCG AAAGGGTTGA AGCTAGCCTC TTCTGCTTGT AAGCTTCCTA TTAAGTGTTA
TGTTACATCG GGATCATATA TATATGTACA ACACAAACAG TAGTTAATCA ACTGGACGTA GAAAAAGACT AGCTGGTACC
ATGCAAGTTT GACATGCATG GTTGAAACCA CATTCTTTAC TTTTACTTAA CTGATATAAT AATATAGTTA AGTCTTTTGC
ATGTCCCTGA AAAAAAAAGG TAAAAAGATA CAGACGAAGC AGATGCAAAG AATCTTAGTA GAACTATATG TATTTACATA
TGTGTGTTTT CACACTAGCT AGCTAACAGA TTATGTCTTG TGCACCGTGG TATATTGAGA GAAGAAGAGC CTGCTGCCTG
CTGCATCCAT AAAATACCCT AAATTTCTGC TTTTGCTTTT TTAATTTTTT TATTTGTACT TGCATATATT GTTTTTAGTT
GTGATCACAG AGCTAGATAT AATTTCCACT TAAGACGATA TTGTAGTGTG TGGTTTTAAT CTGTTTTCTA TTTGGATATT
CGATAGGGGG GCGTTTTTGG TTCAGATATC GAATTTGCTC ATTGGCCATA GCTAGCTGTC ATATATGACA AAATTAGTAC
ACCTATTGAC AGGACAAAGC TAGCTACATG CATGTGTGCA TTTTGCTTGG AATCATGTAA GATCACCATC CAATTCGCAA
TTGGGCCACA AAATAGCTAT ATTAGGGAGC CATTTCACAT CACTAAAAAC ATTTTTGGTA CTTGAATCAA CAGCTAATCA
TAATTGGCCC ACTGATTAGC TGTACTCATT TGATCAGCTG GCTATAATCA TCTCCTTCAA CAGACATGCA TGTATATATG
CTATATAGTA CTATACCTTG GAATGTACAT ATTGAAATAA AATAAACATG GATCGGTGTG TAGCGTATCA TATATGCATC
GAGACACATA TTTGTGACAG TACATCGGAA TTTTCTAACA TCATGCATGT TTAATTACTG CATATATGAC TTTCTGTCAC
TTCTATTTTT CAGAATACTA TCTTTGATCA TCTGCTGGTT AGCCTTGCCA TTAGTTCATA TATAGACTTA TATATAATTT
TGTTTTCAAT GTTAATGCAC TAAAAATTGT GCTCCATTCG AACAAAATGC AGAGAAATTA AAAGATGATT CAGATTGGTC
CAAAATACAT ATATATAGTT AGCATGGTCA AGTAATTTAA TGAGTTTGCC GATTTGATAT ATCAGTTTTT TATTTCGTCA
AATACACGAT GATATATATA GGTGCATGAA ATAATTCTCA GTATTGCTAA TTGATCGTTA TTTCAGCAGG ATGTGAAATT
AGTTAATAAT TGCCGCTATA TATACCTGTC ATATCTTCGT ATTAGGACTT ATCCACATGG ACACATCCAT TTTATGTCAC
TGAAAGCTCA CTATACTTCT TAATTTTTAA TATGCTTGCT TATAATTTAT CTATTAGCGG GAGAAGCATC AATGATATAC
GATGGAATAA TAAATTAATG CATGATATTT TATCCATCAT GATTAAAATA CAGTGCGATA GCGCCCATGA ATATTACGAT
ACACGAGTAT ATATGCTTTT AATAAGATTT TAGTGAAGCT AGTGAGTTAC AATCGCTACT ATAGCTTCAT CTCTTTGAGC
ATATGTTAGG GAACATATTT AGAGATGAGT AAGTGTGGTG TGCCGCACGC GTAAGAGTAC TTTGTGAAAT CGGAAAAATT
AATCTTTATT AACAGACCGT GCGTGGGACA TATTTTAGGC CGTGTGAGTA TTGTGGTAAT CGAAAAAAAT ATTGTTAATA
AACCATGTGC ACGAGATAGA TGGATGTACT AGTTAATGGG GGTACTAGTT ATTTTAACAA GTAGTGCTGT TGCATATCAA
ATATGCACAT TTAATTTCTC TCTTATATAT ACAGCATATA TATGTATCCG GGATAAATAT GCCGTGCAAA TTAAATTGAT
TTTTGTGCCA TCAGCTATAT ATTCTTATGC ACGGAATGCA GATATATAGA AAATTCAGTA CATGGCTTTC TTTATACCGT
GGCTAACGTA CGTATACGCA TCCATATGCA TGGATCCGTA TATATGCCTC CAGGGACTTT TGTATGTGTA TCGCCTCGTA
CTCTCTGTTG TTTGAATGTT TTTGTAGATC TAGCGATCAA TGTGTTTAAT TAATTAACCG AACGCTACCA ACAGTACTAC
ACCACTTATA CAGCACCTGC TGACTTTAAT TTAAAGTATA TATACTTTTT GAGATTTAAC CAAGTTATAG TTGATGAATG
TTACGTGCTA CACAGCGCTT GTGCTTTAAT TAGATCGACC AAACCTAGCT GGCTAGCTAG CGTATTACTC TAATTAATAT
ACTCGATCGG TATATATATA AGAGCTTAGC ATGCGTGGAA CAGTACGGTA CAAATTAATT TTGTGTCATT TTGACTCATT
GTGTGTGTGT AAGTCTGTAT AGAATTGTTC ATTGTGTATA ATTAAGCTTG TATACAATTA ATTAATTGTG CAATTATATA
TATTGTGTGT AAGATTATAA CATGGGAAAG CTGTTCGTGT ATGCACCATG TATGCGTGTA AGCTAACGAG GATATATTGC
GGCCGATGGA TACATGGCAC CTATCCCTAA AATTCATTTT TTTAATTAGT CCCTTTTACT GTCCTTTCCT GCTGCTTAAT
TGAGCCCATA TATATTAATC TACTCTGGCA TCAATATAGA AGAAACGAGA AGAAGTCTAA GGCCCATTCC ATTATTTGTA
CTGAGAGCTG CAGAATTTGT AAGAACTTTG GTATACGAAA TATTCCCACT AATTTGAATG TTGGTTTTCC TACAAAATTC
TCGATACACT AGAGTGAAGT GCTCAAGACA ACAAACATGA ATTGGAGTGC GTGTAGTGGT TAGCTAGCTA ATTATAATTA
ATCTTTGATT AATGATATAG ATATAGTAAA GGGAAACATa tatcctatgc acacaaactt tccgtgcata ccaactaata
aatatcatga aaaattatag aaaaaattgg atatttattc ataatagtCG AGATGATGCA GTACATATAT ATCCTATCTG
TTTCTAATTA ACATTAACAC GAGATTTATG GCGAGGGGCA GCAGAAAATT ACTCAGAATT AAATAACAAC CTTTTCTGTC
TTAGCAAGTA GTAGCAACGT CAGACTGACG TCGTTGCATA AATATATGTA CAGTTGTCTC CAACTACAAG GACGTACAGA
CTGACGCTAC GGAGATATGT CGAATACGTC ATAAGTTAGG ACCATGTCCA AAGCATGCAT GACATTGTTG TTGTTTTCCT
GAAATATTTG GAAATTATAT ATTCAGAAGA CTTAGCTATA TATATACACG CATATATATA ATAATTAATT AAATAGCTAC
TAGCTAGTAG GTGCGAGTAC CACGCGCGTA CGTACGTACA CCTCTCTAGC TAGCTGTATT CCTGTACGTA TTTAGTGTAT
GGTACAGGGA CATGATCAGT ACAGATTATA TATTATTCAT GGTAACGTGT AACCTTGTAT GCCATATGGA CGTATTATGC
ATATAATGTG ACTGATTCAA TTGGTGCAAA TGCATGGCTA CTAAGCAAGC TTCCCCTGCT CTAGAATTAT TGATTAGTTA
ACAAATTTTG TCGGTTCAAT TCCAACCTGG TCATATCATA AGTACAGGTT CTGTTAGTTC TTCCCTTGCA TCTTGACGAA
CACTCTCAAT TTAATTTCTT GAATCTTGAC GAGTAGTCCG TCAAAATCTT AAATCATAGC TATAGAGACT ACCGTCCTGG
TAAGAATTCA TTAATTACAT CGATGAATGT CTGGCAGTAC TTAATTTACC AGAAAACTGG TGAATTAATC AGCCATCGAT
GATCGTTGCC TGTTGCCACA ATCTGTTGAT TGATTTTTTT TCCCCTACTT CCATCGTCAA AACGATCAAT TATTAGTCTT
GCGCAACACC AAGTTGAACT CCGTACATCA TCAGACGATG CTATGTTGTT TAATTTGCAT ATCGTCGGAG CTCTGAACTC
ATGAACTTAA GTACGTGGAT ACACTATCAT CATTCTACCT ACACCGCCTT CTGTAGAAAA TTATACGGGA GTTTTTCTAA
TTTATATGGA ATTTAACTGT TTACCGCAGC TGTAAATTAA ATTCCTAATT CCTGTACAAC AGTACAAGAA GACTGATCAT
ATATCCAATA TCCATGATTT TTTAGTAGAT ATAGTCGGTC CTTCCATAGT TATGTGGTTT AATTTGTTTA CTATGATCTA
ACTAGTTTAG ATATCCTCAA GTTGTTTTCC ACTTTATCCA CACTTTCAAT CAAAACCATG CGCGCTTAAT GCCTTTATAA
ACATTATAAA CACGGCGAGA AGAGATTGAA ATGTCCTGAC GTCGCATAGA TCGAAAGCTA GTTAATTAAT TAAGCTAATT
AATTAGACGT CCAGCTGAAA GCCTGAAAGC TAAAGCTCGA AATCATACAC G

Locus: Os04g0660100

Loading...

Locus: Os04g0660100

Loading...