Os04t0661200-01

Locus

Os04g0661200

Description

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1, Tolerance to salt and drought stresses

RAP-DB Gene Symbol Synonym(s)

OsIPK1

RAP-DB Gene Name Synonym(s)

inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIPK1, IPK1

Oryzabase Gene Name Synonym(s)

inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1

Transcript Evidence

AK102842

Protein Evidence

Q7XQZ6

Literature

PMID: 33374298

Note

Manual Curation

January 12, 2021

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: inositol pentakisphosphate 2-kinase activity (GO:0035299)

Functional domain (InterPro)

Inositol-pentakisphosphate 2-kinase (IPR009286)

Full-length cDNA

J033109O19 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0661200-01)

RiceXPro (AK102842)

Others

Oryzabase (11887)

KEGG (Os04t0661200-01)

Transcript

1874 bp

>Os04t0661200-01 Inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1, Tolerance to salt and drought stresses
CGCTTTCCTCATCGTCGGCTCCACTTCCACTTCCTCTTCCTCCTCCTCGAGGACGAGGAG
GAAATTGGCAGCTGGAGGCTTGGAGCGCGCTGCATCATCCCGCCCGCCCTGCTGCTGCGG
CGATCGCCGGAGCAGGGCTGCAGGGGATCCCCACGGCCGCAGCAGCTGTTGTTATCTGAT
TCTGTGTGGGGATGGAGGTGGTTCTGCATGAGGGGGATGCCAAAGATTGGGTTTACAAAG
GAGAAGGTGCAGCGAATCTAATCCTCAGCTACACTGGCTCGTCACCTTCTATGCTTGGCA
AGGTTCTGCGAGTCAAAAAGATTCTAAAAGACAAGGGACAACCGGCACCAAACTGTATAG
TCTTCTCAAGTCATGAGGAACATCTGTGGGGCAAGATCCCAGGATTGTTGGAATCTGTTA
AAAATGATTGCTTGCCACAAGCCTATGCTACAATTGTTATGAGCCAACATTTGGGTGCCA
ATCATGTTGATGGCGGGGTCCGTGTACGTGTGTCTAAGAACTTTTTCGAGCTTGCTGGAA
AGAATGTGCTTGACAACCGTCCTGCATGGAGAGTGAATGCTAGTGCAATTGATGCTGGAG
CTGATTCTGCTCTTCTAATTTCTGACCACACATTATTTTCCGGTAATCCTAGAGGAAGCA
GTTGCATAGCAGTGGAGATAAAGGCAAAATGTGGATTTCTTCCGTCATCTGAATACATAT
CGAAGGAGAATTCTATCAAGAAACAAGTAACACGGTATAAGATGCATCAGCACCTAAAAT
TTCATCTGGGAGAGATATCGAAGACAAGTGAATACGATCCCCTAGATTTATTTTCTGGAT
CAAAAGAAAGAATACATATGGCTATCAAGTCATTTTTTTCAACTCCTCAGAACAACTTTA
GAATTTTTGTGGATGGTTCTTTAGTTTTTGGTGGCATGGGAGGTGGCGCAGATAGTGTTC
ATCCTAATGAAACAGAGAAATGTCTTGAAGATCTGAGCAAGGTTACTGGCTTACAACTAT
CTGACTTTATTGAGCTCCTGTCAGAGGCAATCTTTAAGTCTGGAGTGTTGGGTAAACTTT
TAGCCACTCAAAAACTGGATGATCATGACATCGAAGGGGCGATTCATCTGTACTATAACA
TCATTTCTCAGCCTTGTTTGGTATGCAAAAGTATAACTGATACAGAACTTCTGCGCAAGT
ACTCCACCTTGCATTCTCTTCCATTGGACAAGAGTGAGAAGATTGTCAGGGACTTTCTTA
TCTCTGCTACTGCAAAAGATTGTAGCCTAATGATCAGCTTTCGACCAAGACAGAGTGGAA
CAACAGATTCTGAGTACGATTCTGTATTTCTTGATTCAGTGAACCAAAGCTATGATTACA
AGGCATATTTTATTGATCTGGATGTGAAACCCTTGGATAAGATGGTACATTACTTTAAAT
TGGATCAAAAGATAGTCAATTTCTACACTAGAAATGGAGAAGTTGGGGGAGATCCACGTG
ATCCTCCAAAGGGATGTGGCCCTAGGTGACACAAAGGTTCAGCTCCAAAGGTTCAGCTCC
AACATTGACGACCTTGAAATATAAAGGGCATAGGACAAGTGTCTGTTGTATCTTGGTGAT
TGTTGTGTTTCTACAAGTGTGCATGTCCAATGTGCAGGTTCTCCTCCCTTCTAGGGAAAA
CGTGTAAGAGAGTGGTAGTTGTTGTAGTACATCCTGTATACCGTGTGGTTTGCCTCAGCA
GTAGGCCGAATTTTCAGTAGACAAACATTAAGAAGAGTTAATAAACTGTATACTGAGGCA
TCCACGTTTACCTTGGAAATCTATGATAAATTCCCGTATACTCAGCTTGCTGTGAATCTG
TGATCTGAGTTCTG

CDS

1338 bp

>Os04t0661200-01 Inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1, Tolerance to salt and drought stresses
ATGGAGGTGGTTCTGCATGAGGGGGATGCCAAAGATTGGGTTTACAAAGGAGAAGGTGCA
GCGAATCTAATCCTCAGCTACACTGGCTCGTCACCTTCTATGCTTGGCAAGGTTCTGCGA
GTCAAAAAGATTCTAAAAGACAAGGGACAACCGGCACCAAACTGTATAGTCTTCTCAAGT
CATGAGGAACATCTGTGGGGCAAGATCCCAGGATTGTTGGAATCTGTTAAAAATGATTGC
TTGCCACAAGCCTATGCTACAATTGTTATGAGCCAACATTTGGGTGCCAATCATGTTGAT
GGCGGGGTCCGTGTACGTGTGTCTAAGAACTTTTTCGAGCTTGCTGGAAAGAATGTGCTT
GACAACCGTCCTGCATGGAGAGTGAATGCTAGTGCAATTGATGCTGGAGCTGATTCTGCT
CTTCTAATTTCTGACCACACATTATTTTCCGGTAATCCTAGAGGAAGCAGTTGCATAGCA
GTGGAGATAAAGGCAAAATGTGGATTTCTTCCGTCATCTGAATACATATCGAAGGAGAAT
TCTATCAAGAAACAAGTAACACGGTATAAGATGCATCAGCACCTAAAATTTCATCTGGGA
GAGATATCGAAGACAAGTGAATACGATCCCCTAGATTTATTTTCTGGATCAAAAGAAAGA
ATACATATGGCTATCAAGTCATTTTTTTCAACTCCTCAGAACAACTTTAGAATTTTTGTG
GATGGTTCTTTAGTTTTTGGTGGCATGGGAGGTGGCGCAGATAGTGTTCATCCTAATGAA
ACAGAGAAATGTCTTGAAGATCTGAGCAAGGTTACTGGCTTACAACTATCTGACTTTATT
GAGCTCCTGTCAGAGGCAATCTTTAAGTCTGGAGTGTTGGGTAAACTTTTAGCCACTCAA
AAACTGGATGATCATGACATCGAAGGGGCGATTCATCTGTACTATAACATCATTTCTCAG
CCTTGTTTGGTATGCAAAAGTATAACTGATACAGAACTTCTGCGCAAGTACTCCACCTTG
CATTCTCTTCCATTGGACAAGAGTGAGAAGATTGTCAGGGACTTTCTTATCTCTGCTACT
GCAAAAGATTGTAGCCTAATGATCAGCTTTCGACCAAGACAGAGTGGAACAACAGATTCT
GAGTACGATTCTGTATTTCTTGATTCAGTGAACCAAAGCTATGATTACAAGGCATATTTT
ATTGATCTGGATGTGAAACCCTTGGATAAGATGGTACATTACTTTAAATTGGATCAAAAG
ATAGTCAATTTCTACACTAGAAATGGAGAAGTTGGGGGAGATCCACGTGATCCTCCAAAG
GGATGTGGCCCTAGGTGA

Protein

446 aa

>Os04t0661200-01 Inositol 1,3,4,5,6-pentakisphosphate 2-kinase 1, Tolerance to salt and drought stresses
MEVVLHEGDAKDWVYKGEGAANLILSYTGSSPSMLGKVLRVKKILKDKGQPAPNCIVFSS
HEEHLWGKIPGLLESVKNDCLPQAYATIVMSQHLGANHVDGGVRVRVSKNFFELAGKNVL
DNRPAWRVNASAIDAGADSALLISDHTLFSGNPRGSSCIAVEIKAKCGFLPSSEYISKEN
SIKKQVTRYKMHQHLKFHLGEISKTSEYDPLDLFSGSKERIHMAIKSFFSTPQNNFRIFV
DGSLVFGGMGGGADSVHPNETEKCLEDLSKVTGLQLSDFIELLSEAIFKSGVLGKLLATQ
KLDDHDIEGAIHLYYNIISQPCLVCKSITDTELLRKYSTLHSLPLDKSEKIVRDFLISAT
AKDCSLMISFRPRQSGTTDSEYDSVFLDSVNQSYDYKAYFIDLDVKPLDKMVHYFKLDQK
IVNFYTRNGEVGGDPRDPPKGCGPR*

5'UTR

chr04:33739201..33739378 (- strand) : 178 bp

chr04:33738938..33738950 (- strand) : 13 bp

CDS

chr04:33738836..33738937 (- strand) : 102 bp

chr04:33737788..33737991 (- strand) : 204 bp

chr04:33737448..33737592 (- strand) : 145 bp

chr04:33736795..33736835 (- strand) : 41 bp

chr04:33736608..33736718 (- strand) : 111 bp

chr04:33735781..33736368 (- strand) : 588 bp

chr04:33735490..33735636 (- strand) : 147 bp

3'UTR

chr04:33735145..33735489 (- strand) : 345 bp

FASTA

>Os04t0661200-01 class=Sequence position=chr04:33735145..33739378 (- strand)
CGCTTTCCTC ATCGTCGGCT CCACTTCCAC TTCCTCTTCC TCCTCCTCGA GGACGAGGAG GAAATTGGCA GCTGGAGGCT
TGGAGCGCGC TGCATCATCC CGCCCGCCCT GCTGCTGCGG CGATCGCCGG AGCAGGGCTG CAGGGGATCC CCACGGCCGC
AGCAGCTGTT GTTATCTGGT AAGCAACTAA AGCTCGCTAT CTGCTCGACG GAATGCCGCA CCGACCAGGA ACCAAGTGTT
GCTTCTTTCT CGCTTGATCT TCTCTTTGGT AGATGAGTAA ATGAATGCAC CTGCACTTGG ACTCGAGTTT GCTGTGTTAC
TCGGCGTTAA GCAGCAATTT TCTGTTCCTC CTACTTCGTT TTTCGCCTAC TATTCCTCCT TACTTATTTT GAATAATAGA
CCTTGAACTC ATACTTGGAA GCCTGCAGAT TCTGTGTGGG GATGGAGGTG GTTCTGCATG AGGGGGATGC CAAAGATTGG
GTTTACAAAG GAGAAGGTGC AGCGAATCTA ATCCTCAGCT ACACTGGCTC GTCACCTTCT ATGGTATGCA TCGAATAGGT
TCTGCTTGTG TCATTATTGG TTACTGACCT ATAGTCTCCC GTAAATCGGC GAATTTGATG CATGTGCTTC AAGAAGGATG
TTTTACTTTT GATGTTCTGA TGATTATAGC TATGAATGTT TGGGTGTCTG GGAGGCGACA GTAGTTCAAG CTCTTTTCAT
GAGATGTTTT GGATGGTGTT TTATGAGGTG ATCTGGAGAT GTAGCCTTGT GCTTGATCTA GCTAGGACCC AGCAGTTGGT
GTCTAGTCGT TTCTGTCCTA GTTTAGCTAG CTGTTTTTAT TTTCCTATAA GACTCTGTTT GTTTGGCTTT CCTCACAAAG
CCGGTTTAAT GAATGCCTGA TTTCCCCCCA AAAAGATGTT TTACCAACTT TGATGCAACG CCCAGGGATG CATGTCCTAT
GGCCAGAGCT GCACTCTTGA AATGGCAAAT GTTTGTATAT GTAAATTAGA AAATCCCATA CAGCTTTCAT GTAGTCAAAT
AGTTTCACTT TAATATTATA TAATTCAAAA GAAAATAATC TTAGTTGTGT GATCACACAA AAAGAAGGGG TGGTGGCGGC
GCCATCTTAG TTGTGTGATC TGCCTGCCCG GTCTAGTTTT GTTTTTTTGT TCAATTCCTT TTGCTGTATT GCTACAACAT
TGTTGTTTCC TGTAATGGAA AGAGGGAGAG CAAGGTTCTT CTGTTTTTTA AAAGAAGAGA GGAAAAAGAG AAAATAATCT
TATCTTGACT TGGTTGACTA AAATTTTTAG TTTGTGACCA AAGTATTATG TTTCCCTCGT ATGATATGTT TACAGGAAAA
ATGTTTTGAT GATGTTTTCT TGAACAGCTT GGCAAGGTTC TGCGAGTCAA AAAGATTCTA AAAGACAAGG GACAACCGGC
ACCAAACTGT ATAGTCTTCT CAAGTCATGA GGAACATCTG TGGGGCAAGA TCCCAGGATT GTTGGAATCT GTTAAAAATG
ATTGCTTGCC ACAAGCCTAT GCTACAATTG TTATGAGCCA ACATTTGGGT GCCAATCATG TTGATGGCGG GGTATGTTTT
AAATCCAATT ATTTAATGTT GTTACGGTGA TATTTATTAG AAATAAATCA ACCAACGTTT TCCAATTTAA AATTCTTTTG
CTCTATAATT AATGGAAAAT TCGGGTTATT TGAAAATACA TCCTTGATTA GATAATTGGA TCCACTTGAC TAAAATGAAT
AAACGTGGTC TCTTTTTCAT GTTCAGGTCC GTGTACGTGT GTCTAAGAAC TTTTTCGAGC TTGCTGGAAA GAATGTGCTT
GACAACCGTC CTGCATGGAG AGTGAATGCT AGTGCAATTG ATGCTGGAGC TGATTCTGCT CTTCTAATTT CTGACCACAC
ATTATTTTCC GGTAAAGTCT TGGCGTTTCA ATGTTATTTG AACGCTTCAT CTCTTTCCCT TTTGAGTATA ATGTGACTCT
TGTTTGTACT AAGAAAGAGC AAATATCAGT TAGGTCTGGT GATCTATTAA CTCTTTATGA TATAACATTT GCAGCAACAC
TGTTACTCAG TTTATTATTT CTATTTGCAT CACATGCTTT AACCTTATTT GTTTGTTAAG AGTGGCAAGT TTGTAATTTA
TGGTTTTCTA GTCTACAACC AAATAGATAG GATCAAGATT GGTAAGCCCA ACTTTCTCCA TGACACTTGT GAAACTTGGG
ATATGTTTGG AAGGATTCAT ACAATTTATA TTTCTCAAGA TTCTCCATTA TTCTGAAACA TGGAAAGAAT GAAAGAACCT
GCTTGTTTTT TCGAATTTCT AGCTTAACTC TGATCTGTTC CATCCGCAAG AGCTTGTTTC CGTCCTAAAA TTGGTAGTTG
GTCCAAAATT GATTAGTTTG AATGATTAAA GATGATTCGG TAGTTTTTTA CATTGCGCCA TTGCTAAATT ATTATTCGTA
ACTCGCTGCT AGATTTTGTT TTTTAACACT ATGTTTGTTT TTGGTAATTT TTCTAAACCT CAGGTAATCC TAGAGGAAGC
AGTTGCATAG CAGTGGAGAT AAAGGTACAT TTTGAGCTTT ATTTATTTCT TCACTGTTCA TCTTTTGTAC ACATTTCTTT
TAACATGCTT TGCCTTCCAG GCAAAATGTG GATTTCTTCC GTCATCTGAA TACATATCGA AGGAGAATTC TATCAAGAAA
CAAGTAACAC GGTATAAGAT GCATCAGCAC CTAAAATTTC ATCTGGGAGA GGTATGTTGG TTTTGGGTAC CAGATTTTGA
TTTCACCGCA GCCATAATTT TGAGTACTAA ATATATAATA GCACACTACT CTTTTGCTCA CTGAAAGACA ACAAACTACT
CTTCTAGCTG AAACAGATAT TAATAGATGC TTCATATTCA TTCTGTCACT CTTGGAAGTT GCAATGCTAT ATCATCCCTT
TTGCTTTTCA AATCAGCTTG GTTCTAAACA TATTTTTAAA CACATTTCAG ATATCGAAGA CAAGTGAATA CGATCCCCTA
GATTTATTTT CTGGATCAAA AGAAAGAATA CATATGGCTA TCAAGTCATT TTTTTCAACT CCTCAGAACA ACTTTAGAAT
TTTTGTGGAT GGTTCTTTAG TTTTTGGTGG CATGGGAGGT GGCGCAGATA GTGTTCATCC TAATGAAACA GAGAAATGTC
TTGAAGATCT GAGCAAGGTT ACTGGCTTAC AACTATCTGA CTTTATTGAG CTCCTGTCAG AGGCAATCTT TAAGTCTGGA
GTGTTGGGTA AACTTTTAGC CACTCAAAAA CTGGATGATC ATGACATCGA AGGGGCGATT CATCTGTACT ATAACATCAT
TTCTCAGCCT TGTTTGGTAT GCAAAAGTAT AACTGATACA GAACTTCTGC GCAAGTACTC CACCTTGCAT TCTCTTCCAT
TGGACAAGAG TGAGAAGATT GTCAGGGACT TTCTTATCTC TGCTACTGCA AAAGATTGTA GCCTAATGAT CAGCTTTCGA
CCAAGACAGA GTGGAACAAC AGATTCTGAG TACGATTCTG TATTTCTTGA TTCAGTGAAC CAAAGCTATG ATTACAAGGT
ATTGATGTGA TATGTTTCTT GTTTGAGAAG TTCGATAAGT CATCTAGTTC CTTGTGGAAC AATTGTTTTT TTCTTTCTAA
AAACTCTTTT TATTAATGTT TCTTTCCCAC CAACCCATTG ATTTGCACAT TTGTTGTTGC AGGCATATTT TATTGATCTG
GATGTGAAAC CCTTGGATAA GATGGTACAT TACTTTAAAT TGGATCAAAA GATAGTCAAT TTCTACACTA GAAATGGAGA
AGTTGGGGGA GATCCACGTG ATCCTCCAAA GGGATGTGGC CCTAGGTGAC ACAAAGGTTC AGCTCCAAAG GTTCAGCTCC
AACATTGACG ACCTTGAAAT ATAAAGGGCA TAGGACAAGT GTCTGTTGTA TCTTGGTGAT TGTTGTGTTT CTACAAGTGT
GCATGTCCAA TGTGCAGGTT CTCCTCCCTT CTAGGGAAAA CGTGTAAGAG AGTGGTAGTT GTTGTAGTAC ATCCTGTATA
CCGTGTGGTT TGCCTCAGCA GTAGGCCGAA TTTTCAGTAG ACAAACATTA AGAAGAGTTA ATAAACTGTA TACTGAGGCA
TCCACGTTTA CCTTGGAAAT CTATGATAAA TTCCCGTATA CTCAGCTTGC TGTGAATCTG TGATCTGAGT TCTG

Locus: Os04g0661200

Loading...

Locus: Os04g0661200

Loading...