Os04t0669800-01

Locus

Os04g0669800

Description

Methylthioribose kinase (EC 2.7.1.100).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MTK1

CGSNL Gene Name

METHYLTHIORIBOSE KINASE 1

Oryzabase Gene Symbol Synonym(s)

OsMTK, OsMTK1, MTK

Oryzabase Gene Name Synonym(s)

Methylthioribose Kinase 1, MTR kinase 1

Transcript Evidence

AK067649 (DDBJ, Best hit)

Protein Evidence

Q7XR61 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: methionine biosynthetic process (GO:0009086)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Molecular Function: S-methyl-5-thioribose kinase activity (GO:0046522)

Functional domain (InterPro)

Aminoglycoside phosphotransferase (IPR002575)

Methylthioribose kinase (IPR009212)

Protein kinase-like domain (IPR011009)

Full-length cDNA

J013114G08 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0669800-01)

RiceXPro (AK067649)

Others

Oryzabase (11130)

KEGG (Os04t0669800-01 (EC:2.7.1.100))

Transcript

1697 bp

>Os04t0669800-01 Methylthioribose kinase (EC 2.7.1.100).
ACACGCGCACTCGATTCCCCACTCCTCTCGCGGGTCGCGGCCACTTCGCCGCCGGCGCTC
GCATCGGTCAACTCGACGCCACGGCCACACACGCACCGGCCATGGCCGCGGCGGCGGAGC
AGCAGCAGCAGCAGCAGCAGCAGGGCTTCCGCCCGCTCGACGAGGCGTCCCTGGTGGCCT
ACATCAAGGCCACGCCCGCCCTCGCCGCGCGCCTCGGCGGCAGCCTCGACGCCCTCACCA
TCAAGGAGGTCGGCGACGGCAACCTCAACTTCGTCTACATCGTCCTCTCCGACGCCGGCT
CCGTCGTCATCAAGCAGGCGCTGCCGTACATCCGCTGCGTGGGGGATTCGTGGCCGATGA
CGAGGGAGCGCGCCTACTTCGAGGCCTCCGCGCTGCAGAAGCACCGCGGCCTCTGCCCGG
ACCATGTCCCCGAGGTCTACCACTTCGACCGGGCCATGTCGCTGATCGGGATGCGCTACA
TCGAGCCGCCGCACATCATCCTCCGCAAGGGCCTCATCGCTGGCGTCGAGTACCCGCTGC
TCGCCGAGCACATGGCGGATTACATGGCCAAGACGCTCTTCTTCACCTCCCTTCTCTACA
ACTCCACCACTGATCACAAGAAAGGAGTTGCTCAGTACTGCGATAATGTGGAGATGTGTA
GGCTCACAGAGCAAGTCGTGTTCTCAGACCCATACATGCTCGCCAAATACAATCGTTGCA
CATCACCCTTCCTAGATAATGATGCTGCAGCGGTTCGAGAGGATGCTGAGCTTAAATTGG
AGATTGCTGAATTGAAATCAATGTTTATTGAGAGAGCACAGGCTCTTCTTCATGGAGATC
TCCACACTGGTTCCATCATGGTGACACCAGATTCTACTCAAGTGATTGATCCAGAATTTG
CTTTCTATGGCCCAATGGGTTACGACATTGGGGCCTTCCTGGGGAACTTGATTTTGGCAT
ATTTTTCACAAGATGGACACGCTGATCAAGCAAATGATCGTAAGGCTTACAAGAAATGGA
TCTTGAAGACAATTGAAGATTCATGGAATTTGTTCCACAAGAAGTTTGTCGAATTATGGA
ATAAACACAAAGATGGGAATGGGGAAGCATACCTGCCCCCTATATACAACAGCTCAGAGC
TTTTGTGCCTTGCACAGAAGAAGTACATGACAAGCCTATTTCATGACAGTCTTGGATTTG
GTTCAGCAAAAATGATCAGGAGAATTGTTGGAATTGCTCATGTTGAGGATTTTGAGTCGA
TTGAGGATGCCAGCAAGAGAGCTTCGTGTGAGCGACGTGCCCTTAATTGTGCAAAGGCAA
TCCTGAAGGGAAGACGCCAGTTTGAAAGCATCGGGCAAGTGATTGTGCATGTACAATCGT
TTGATCGGGACTGATAATGCCAACCATCTACACGACCTTTCTGATTGAGGAGACAAAAGT
TTTCATCTGTTTACCATAAGCGATTATCTGTGCCTATTACAAAGCAGAATTGGCCAGTTA
TTTGTGCTTTTAGTACTTTGGATCATGAAAAGTGTGTGCACTCTGCAAGATCGATGTTTT
TTTTCACCACTTGGCTAAGCCTTCCACCAGCTTCCGGGCTTCTTAGTTTATGAGCTGAAT
AATGGAAGTTCAGCACAAACGTTTGTCCATGGATATGGACGAGTGTGTTATTACAAATAA
AGTTGATAGTTTTCGGC

CDS

1293 bp

>Os04t0669800-01 Methylthioribose kinase (EC 2.7.1.100).
ATGGCCGCGGCGGCGGAGCAGCAGCAGCAGCAGCAGCAGCAGGGCTTCCGCCCGCTCGAC
GAGGCGTCCCTGGTGGCCTACATCAAGGCCACGCCCGCCCTCGCCGCGCGCCTCGGCGGC
AGCCTCGACGCCCTCACCATCAAGGAGGTCGGCGACGGCAACCTCAACTTCGTCTACATC
GTCCTCTCCGACGCCGGCTCCGTCGTCATCAAGCAGGCGCTGCCGTACATCCGCTGCGTG
GGGGATTCGTGGCCGATGACGAGGGAGCGCGCCTACTTCGAGGCCTCCGCGCTGCAGAAG
CACCGCGGCCTCTGCCCGGACCATGTCCCCGAGGTCTACCACTTCGACCGGGCCATGTCG
CTGATCGGGATGCGCTACATCGAGCCGCCGCACATCATCCTCCGCAAGGGCCTCATCGCT
GGCGTCGAGTACCCGCTGCTCGCCGAGCACATGGCGGATTACATGGCCAAGACGCTCTTC
TTCACCTCCCTTCTCTACAACTCCACCACTGATCACAAGAAAGGAGTTGCTCAGTACTGC
GATAATGTGGAGATGTGTAGGCTCACAGAGCAAGTCGTGTTCTCAGACCCATACATGCTC
GCCAAATACAATCGTTGCACATCACCCTTCCTAGATAATGATGCTGCAGCGGTTCGAGAG
GATGCTGAGCTTAAATTGGAGATTGCTGAATTGAAATCAATGTTTATTGAGAGAGCACAG
GCTCTTCTTCATGGAGATCTCCACACTGGTTCCATCATGGTGACACCAGATTCTACTCAA
GTGATTGATCCAGAATTTGCTTTCTATGGCCCAATGGGTTACGACATTGGGGCCTTCCTG
GGGAACTTGATTTTGGCATATTTTTCACAAGATGGACACGCTGATCAAGCAAATGATCGT
AAGGCTTACAAGAAATGGATCTTGAAGACAATTGAAGATTCATGGAATTTGTTCCACAAG
AAGTTTGTCGAATTATGGAATAAACACAAAGATGGGAATGGGGAAGCATACCTGCCCCCT
ATATACAACAGCTCAGAGCTTTTGTGCCTTGCACAGAAGAAGTACATGACAAGCCTATTT
CATGACAGTCTTGGATTTGGTTCAGCAAAAATGATCAGGAGAATTGTTGGAATTGCTCAT
GTTGAGGATTTTGAGTCGATTGAGGATGCCAGCAAGAGAGCTTCGTGTGAGCGACGTGCC
CTTAATTGTGCAAAGGCAATCCTGAAGGGAAGACGCCAGTTTGAAAGCATCGGGCAAGTG
ATTGTGCATGTACAATCGTTTGATCGGGACTGA

Protein

431 aa

>Os04t0669800-01 Methylthioribose kinase (EC 2.7.1.100).
MAAAAEQQQQQQQQGFRPLDEASLVAYIKATPALAARLGGSLDALTIKEVGDGNLNFVYI
VLSDAGSVVIKQALPYIRCVGDSWPMTRERAYFEASALQKHRGLCPDHVPEVYHFDRAMS
LIGMRYIEPPHIILRKGLIAGVEYPLLAEHMADYMAKTLFFTSLLYNSTTDHKKGVAQYC
DNVEMCRLTEQVVFSDPYMLAKYNRCTSPFLDNDAAAVREDAELKLEIAELKSMFIERAQ
ALLHGDLHTGSIMVTPDSTQVIDPEFAFYGPMGYDIGAFLGNLILAYFSQDGHADQANDR
KAYKKWILKTIEDSWNLFHKKFVELWNKHKDGNGEAYLPPIYNSSELLCLAQKKYMTSLF
HDSLGFGSAKMIRRIVGIAHVEDFESIEDASKRASCERRALNCAKAILKGRRQFESIGQV
IVHVQSFDRD*

5'UTR

chr04:34158549..34158649 (- strand) : 101 bp

CDS

chr04:34158333..34158548 (- strand) : 216 bp

chr04:34157938..34158247 (- strand) : 310 bp

chr04:34157615..34157789 (- strand) : 175 bp

chr04:34157334..34157535 (- strand) : 202 bp

chr04:34156698..34156912 (- strand) : 215 bp

chr04:34155839..34156013 (- strand) : 175 bp

3'UTR

chr04:34155536..34155838 (- strand) : 303 bp

FASTA

>Os04t0669800-01 class=Sequence position=chr04:34155536..34158649 (- strand)
ACACGCGCAC TCGATTCCCC ACTCCTCTCG CGGGTCGCGG CCACTTCGCC GCCGGCGCTC GCATCGGTCA ACTCGACGCC
ACGGCCACAC ACGCACCGGC CATGGCCGCG GCGGCGGAGC AGCAGCAGCA GCAGCAGCAG CAGGGCTTCC GCCCGCTCGA
CGAGGCGTCC CTGGTGGCCT ACATCAAGGC CACGCCCGCC CTCGCCGCGC GCCTCGGCGG CAGCCTCGAC GCCCTCACCA
TCAAGGAGGT CGGCGACGGC AACCTCAACT TCGTCTACAT CGTCCTCTCC GACGCCGGCT CCGTCGTCAT CAAGCAGGTC
CCTATCTCCT CCACGCGCCG CCGCCGCCAC ACATGTACGC ATCTTCTCTC TCCGTTCCTC CGCTGACGAC GCTGCAATCC
AGGCGCTGCC GTACATCCGC TGCGTGGGGG ATTCGTGGCC GATGACGAGG GAGCGCGCCT ACTTCGAGGC CTCCGCGCTG
CAGAAGCACC GCGGCCTCTG CCCGGACCAT GTCCCCGAGG TCTACCACTT CGACCGGGCC ATGTCGCTGA TCGGGATGCG
CTACATCGAG CCGCCGCACA TCATCCTCCG CAAGGGCCTC ATCGCTGGCG TCGAGTACCC GCTGCTCGCC GAGCACATGG
CGGATTACAT GGCCAAGACG CTCTTCTTCA CCTCCCTTCT CTACAACTCC ACCACTGATC ACAAGAAAGG AGGTTGGTTG
ATTTATTATA CAGGTTTGGT TTGCCTGTGA AAAGGGAGAA AAATGAGAAC CAAATTGATA GAATGTTGTG TTCTGTGACT
ATGAAAAGGG AGAAAAATGA TAACCAAATT GATGGAATGT TTGTGTTCTG TGAACTGCAG TTGCTCAGTA CTGCGATAAT
GTGGAGATGT GTAGGCTCAC AGAGCAAGTC GTGTTCTCAG ACCCATACAT GCTCGCCAAA TACAATCGTT GCACATCACC
CTTCCTAGAT AATGATGCTG CAGCGGTTCG AGAGGATGCT GAGCTTAAAT TGGAGATTGC TGAATTGAAA TCAATGTAAC
TATCTTTCCA GATTAAACCA GCGCTTTTCT TTTCTTTTCA TATTGGAGAT GATGGACATG ATTTGCATAT GCAGGTTTAT
TGAGAGAGCA CAGGCTCTTC TTCATGGAGA TCTCCACACT GGTTCCATCA TGGTGACACC AGATTCTACT CAAGTGATTG
ATCCAGAATT TGCTTTCTAT GGCCCAATGG GTTACGACAT TGGGGCCTTC CTGGGGAACT TGATTTTGGC ATATTTTTCA
CAAGATGGAC ACGCTGATCA AGCAAATGAT CGTAAGGTAT GTATGGATTT ATTGGCTAAT AATAGTAAAT GAAAGTGTGT
ACTTTTACCT GGTCCACAAA TGTCCTCTTT TTTTTTTATG TGACAAAAAG ATAGTTTTTC TTTTTGGGTG GTTAAGTTGT
TTTGCGTTTG CTAAGATAAT GGCAACCACA TGTCTTCCTG TGTACTTGTA TCCTATAGAA TAATTAGCAA TTGATATTGT
TGAGATATGC CGTATGTAAC AGAGGGAGGA GGGTGCTCGG CAGACAATAA GTTGAATAAC TTGCCTTACT CATCACTTGA
ATGTCCCTGA GTAATGGGAA CTGCAGAAAT GACAAGTTAT ATGGCAAAGT GCAATGGCAG CATCTAGATT TTAGAAGGTA
TTTTCATGAT GTATCACGGG GCATAAAATA AGTTATATGA CTGTACATAT TTTTCAGGCT TACAAGAAAT GGATCTTGAA
GACAATTGAA GATTCATGGA ATTTGTTCCA CAAGAAGTTT GTCGAATTAT GGAATAAACA CAAAGATGGG AATGGGGAAG
CATACCTGCC CCCTATATAC AACAGCTCAG AGCTTTTGTG CCTTGCACAG AAGAAGTACA TGACAAGCCT ATTTCATGAC
AGTCTTGGAT TTGGTTCAGC AAAAATGATC AGGTAAATAA Atgttgaata gtataggaag aggagattac tgcgaatatt
ggacacattc tattgagcct taggagcccg catatatagg aaataaatag ggtagagata aggaagtatt aTATTTAaca
tggtattaga gcctcagggg ccagtatata gatacatgag ataaggaagg attacagata tggaaaaaat ccacataaat
caatcatatc ctaatatgac tctaactacc atatactcta atatTAAACA GTACAATTAT ATAGTCTATA CTACTAAGTT
AATTTGTTGA ATCTTATTTA CGTCTAGACT ATGAAGATAT ACTAGACCTG CCCTTTTTAA CTGTAAGGAA CTCAAAGGCA
CGCTAATTTA GGCCAAAAGT AGAGGTTTCC GATGTCAATT TTGATGCAGC ACTTCTTTTT CATAAATGTA TGTCAGTATG
TGGTGTCCTA AAAGAGATGT TCCAGAAGAC CACCTTTGAC AAGCATAAAG TATGACTGAA AACCGTCATA AATGGTTGAA
TTGAGGCAAT TCAGGATATT ATGTTGTGAG AAGCTAAGTG TAAAGAACTT AAAATCACAT TTAAACACCA TTTTCAAATT
TTTTATCTGT ATTCCGATGC CTTGTGCATG ATCCTCAAGC GACTTCTGTT TACTAAATTG GACCATACAT ATGTAGGAGA
ATTGTTGGAA TTGCTCATGT TGAGGATTTT GAGTCGATTG AGGATGCCAG CAAGAGAGCT TCGTGTGAGC GACGTGCCCT
TAATTGTGCA AAGGCAATCC TGAAGGGAAG ACGCCAGTTT GAAAGCATCG GGCAAGTGAT TGTGCATGTA CAATCGTTTG
ATCGGGACTG ATAATGCCAA CCATCTACAC GACCTTTCTG ATTGAGGAGA CAAAAGTTTT CATCTGTTTA CCATAAGCGA
TTATCTGTGC CTATTACAAA GCAGAATTGG CCAGTTATTT GTGCTTTTAG TACTTTGGAT CATGAAAAGT GTGTGCACTC
TGCAAGATCG ATGTTTTTTT TCACCACTTG GCTAAGCCTT CCACCAGCTT CCGGGCTTCT TAGTTTATGA GCTGAATAAT
GGAAGTTCAG CACAAACGTT TGTCCATGGA TATGGACGAG TGTGTTATTA CAAATAAAGT TGATAGTTTT CGGC

Locus: Os04g0669800

Loading...

Locus: Os04g0669800

Loading...