Os04t0669900-00

Locus

Os04g0669900

Description

Similar to H0818H01.11 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMTK2

Oryzabase Gene Name Synonym(s)

Methylthioribose Kinase 2, MTR kinase 2

Transcript Evidence

AY593959 (DDBJ, Secondary hit)

Protein Evidence

Q259N8 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: methionine biosynthetic process (GO:0009086)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Molecular Function: S-methyl-5-thioribose kinase activity (GO:0046522)

Functional domain (InterPro)

Aminoglycoside phosphotransferase (IPR002575)

Methylthioribose kinase (IPR009212)

Protein kinase-like domain (IPR011009)

Expression Databases

TENOR (Os04t0669900-00)

Others

Oryzabase (14061)

Transcript

1369 bp

>Os04t0669900-00 Similar to H0818H01.11 protein.
AGCAGCAGCAGCAGGGCTTCCGCCCGCTCGACGAGGCGTCCCTGGTGGCCTACATCAAGG
CCACGCCCGCCCTCGCCGCGCGCCTCGGCGGCCGCCTCGACGCCCTCACCATCAAGGAGG
TCGGCGACGGCAACCTCAACTTCGTCTACATCGTCCTCTCCGACGCCGGCTCCCTCGTCA
TCAAGCAGCAGGCGCTGCCGTACATCCGCTTAGTGGGGGATTCATGGCCGATGTCGAGGG
AGCGCGCCTATTTCGAGGCCTCCGCGCTGCAGAAGCACCGCGCCCTCTGCCCGGACCATG
TCCCCGAGGTCTACCACTTCGACCGTGCCATGTCGCTCATCGGGATGCGCTACATCGAGC
CGCCGCACATCATCCTCCGCAAGGGCCTCGTCGCCGGCGTCGAGTACCCGCTGCTCGCCG
AGCACATGGCGGATTACATGGCCAAGACGCTCTTCTTCACTTCACTTCTCTACAACTCCA
CCACTGATCACAAGAAAGGAGTTGCTCAGTATTGCGATAATGTGGAGATGAGCAGGCTCA
CAGAACAAGTTGTATTCTCAGATCCATACAGGGTCGCCAAATACAATCGCTGCACATCAC
CCTTCCTTGATAATGATGCTGCAGCGGTTCGAGAGGATGCTGAGCTTAAGTTGGAGATTG
CTGAATTAAAATCAATGTTTATTGAGAGAGCACAAGCTTTTCTTCATGGAGATCTCCACA
CTAGTTCCATCATGGTGACACCAGATTCTACTCAAGTGATTGATCCAGAATTTGCTTTCT
ATGGCCCAATGGGTTACGATATTGGGGCCTTCCTGGGGAACTTGATTTTGGCATATTTTT
CACAAGATGGACATGCTGATCAAGCAAATGATCGTAAGGCTTACAAGAAATGGATCTTGA
AGACAATTGAAGATTCATGGAATTTTTTCCACAAGAAGTTTGTCGAATTATGGAATAAAC
ACAAAGATGGGAATGGGGAAGCATACCTGCCCCCTATATACAACAGCTCAGAGCTTTTGA
GCCTTGTACAGAAGAAGTACATGACAAGCCTATTTCATGACAGTCTTGGATTTGGTTCAG
CAAAAATGATCAGGAGAATTGTTGGAATTGCTCATGTTGAGGATTTTGAGTCGATTGAGG
ATGCCAGCAAGAGAGCTTCGTGTGAGCGACGTGCCCTTAATTGTGCAAAGGCAATCCTGA
AGGGAAGACGCCAGTTTGAAAGCATCGAGCAAGTGATTGTGCATGTACAATCGTTTGATC
GGGACTGATAAGGCTAACCATCTACACAACCTTTCTGATTGAGGAGACAAAAGTTTTCAT
CTGTTTACCATCAGCGATTATCTGTGCCTATTATAAAGCAGAATTGGCC

CDS

1266 bp

>Os04t0669900-00 Similar to H0818H01.11 protein.
CAGCAGCAGCAGGGCTTCCGCCCGCTCGACGAGGCGTCCCTGGTGGCCTACATCAAGGCC
ACGCCCGCCCTCGCCGCGCGCCTCGGCGGCCGCCTCGACGCCCTCACCATCAAGGAGGTC
GGCGACGGCAACCTCAACTTCGTCTACATCGTCCTCTCCGACGCCGGCTCCCTCGTCATC
AAGCAGCAGGCGCTGCCGTACATCCGCTTAGTGGGGGATTCATGGCCGATGTCGAGGGAG
CGCGCCTATTTCGAGGCCTCCGCGCTGCAGAAGCACCGCGCCCTCTGCCCGGACCATGTC
CCCGAGGTCTACCACTTCGACCGTGCCATGTCGCTCATCGGGATGCGCTACATCGAGCCG
CCGCACATCATCCTCCGCAAGGGCCTCGTCGCCGGCGTCGAGTACCCGCTGCTCGCCGAG
CACATGGCGGATTACATGGCCAAGACGCTCTTCTTCACTTCACTTCTCTACAACTCCACC
ACTGATCACAAGAAAGGAGTTGCTCAGTATTGCGATAATGTGGAGATGAGCAGGCTCACA
GAACAAGTTGTATTCTCAGATCCATACAGGGTCGCCAAATACAATCGCTGCACATCACCC
TTCCTTGATAATGATGCTGCAGCGGTTCGAGAGGATGCTGAGCTTAAGTTGGAGATTGCT
GAATTAAAATCAATGTTTATTGAGAGAGCACAAGCTTTTCTTCATGGAGATCTCCACACT
AGTTCCATCATGGTGACACCAGATTCTACTCAAGTGATTGATCCAGAATTTGCTTTCTAT
GGCCCAATGGGTTACGATATTGGGGCCTTCCTGGGGAACTTGATTTTGGCATATTTTTCA
CAAGATGGACATGCTGATCAAGCAAATGATCGTAAGGCTTACAAGAAATGGATCTTGAAG
ACAATTGAAGATTCATGGAATTTTTTCCACAAGAAGTTTGTCGAATTATGGAATAAACAC
AAAGATGGGAATGGGGAAGCATACCTGCCCCCTATATACAACAGCTCAGAGCTTTTGAGC
CTTGTACAGAAGAAGTACATGACAAGCCTATTTCATGACAGTCTTGGATTTGGTTCAGCA
AAAATGATCAGGAGAATTGTTGGAATTGCTCATGTTGAGGATTTTGAGTCGATTGAGGAT
GCCAGCAAGAGAGCTTCGTGTGAGCGACGTGCCCTTAATTGTGCAAAGGCAATCCTGAAG
GGAAGACGCCAGTTTGAAAGCATCGAGCAAGTGATTGTGCATGTACAATCGTTTGATCGG
GACTGA

Protein

422 aa

>Os04t0669900-00 Similar to H0818H01.11 protein.
QQQQGFRPLDEASLVAYIKATPALAARLGGRLDALTIKEVGDGNLNFVYIVLSDAGSLVI
KQQALPYIRLVGDSWPMSRERAYFEASALQKHRALCPDHVPEVYHFDRAMSLIGMRYIEP
PHIILRKGLVAGVEYPLLAEHMADYMAKTLFFTSLLYNSTTDHKKGVAQYCDNVEMSRLT
EQVVFSDPYRVAKYNRCTSPFLDNDAAAVREDAELKLEIAELKSMFIERAQAFLHGDLHT
SSIMVTPDSTQVIDPEFAFYGPMGYDIGAFLGNLILAYFSQDGHADQANDRKAYKKWILK
TIEDSWNFFHKKFVELWNKHKDGNGEAYLPPIYNSSELLSLVQKKYMTSLFHDSLGFGSA
KMIRRIVGIAHVEDFESIEDASKRASCERRALNCAKAILKGRRQFESIEQVIVHVQSFDR
D*

5'UTR

chr04:34164341..34164342 (- strand) : 2 bp

CDS

chr04:34164155..34164340 (- strand) : 186 bp

chr04:34163748..34164060 (- strand) : 313 bp

chr04:34163475..34163649 (- strand) : 175 bp

chr04:34163196..34163397 (- strand) : 202 bp

chr04:34162342..34162556 (- strand) : 215 bp

chr04:34161729..34161903 (- strand) : 175 bp

3'UTR

chr04:34161628..34161728 (- strand) : 101 bp

FASTA

>Os04t0669900-00 class=Sequence position=chr04:34161628..34164342 (- strand)
AGCAGCAGCA GCAGGGCTTC CGCCCGCTCG ACGAGGCGTC CCTGGTGGCC TACATCAAGG CCACGCCCGC CCTCGCCGCG
CGCCTCGGCG GCCGCCTCGA CGCCCTCACC ATCAAGGAGG TCGGCGACGG CAACCTCAAC TTCGTCTACA TCGTCCTCTC
CGACGCCGGC TCCCTCGTCA TCAAGCAGGT CCCTATCTCC TCCACGCGCC GCCACCGTCG CCGCTGCCAC ACATGTAGTA
CGCATCTTCT GTCTCCGTTC TTTCGCTGAC GACGCTGCAA TCCAGGCGCT GCCGTACATC CGCTTAGTGG GGGATTCATG
GCCGATGTCG AGGGAGCGCG CCTATTTCGA GGCCTCCGCG CTGCAGAAGC ACCGCGCCCT CTGCCCGGAC CATGTCCCCG
AGGTCTACCA CTTCGACCGT GCCATGTCGC TCATCGGGAT GCGCTACATC GAGCCGCCGC ACATCATCCT CCGCAAGGGC
CTCGTCGCCG GCGTCGAGTA CCCGCTGCTC GCCGAGCACA TGGCGGATTA CATGGCCAAG ACGCTCTTCT TCACTTCACT
TCTCTACAAC TCCACCACTG ATCACAAGAA AGGAGGTTGG TTGATTTATT ACAGGTTTGG TTTGCCTGTG AAAATTGAGA
AGGGAGAAAA ATGAGAACCG AATTGATGGC ATGTTGTGTT ATGTGAATTG CAGTTGCTCA GTATTGCGAT AATGTGGAGA
TGAGCAGGCT CACAGAACAA GTTGTATTCT CAGATCCATA CAGGGTCGCC AAATACAATC GCTGCACATC ACCCTTCCTT
GATAATGATG CTGCAGCGGT TCGAGAGGAT GCTGAGCTTA AGTTGGAGAT TGCTGAATTA AAATCAATGT AACTAGCTCT
CCTGATTAAA CCAGCGTTTC TCTTTCCTTT TCATTGGAGA TGATGGACAT GATTTGCATA TGCAGGTTTA TTGAGAGAGC
ACAAGCTTTT CTTCATGGAG ATCTCCACAC TAGTTCCATC ATGGTGACAC CAGATTCTAC TCAAGTGATT GATCCAGAAT
TTGCTTTCTA TGGCCCAATG GGTTACGATA TTGGGGCCTT CCTGGGGAAC TTGATTTTGG CATATTTTTC ACAAGATGGA
CATGCTGATC AAGCAAATGA TCGTAAGGTG TGTATGGATT TATTGGCTAA TAATAGTAAA TGAAAGTGCG TAATCTTACC
TGGGTGGTTA AGTTGTTTTG CGTTTGCTAA GATAATGGCA ACCACATGTC TTCCTGTGTA CTAATTTCGA TAGGATAGAA
GTTTGGAACA TGATACTTGT ATCCTATAGA ATAACTAGCA ATTGATATTG TTGATATATG CCGTATGTAA CAGAGGGAGG
AGGGTGCTCA GCAGACGATG AATGTCCCTG AGTATtactc cctccgtttc atattataag ttgtttgatt tttttcttag
tcaatttttt ttaagtttaa ccaaatctgt agaaaaatag aataacattt tcaatacaaa acaaacatat tatcaaaata
tattctatgt taaatttaat taaactaatt tgctgttgta aatgttgcta atttttttct ataaatctgg tcaaacctaa
agaactttga ctaagaaaaa agtcaaacga cttataatat gaaatggagg gagtaCTTAA TGGGAACTGC AGAAATGACA
AGTTATGATA TGGCAAAGTG CAATTGCAAC ATCTAGATTC TAGAAGGTAT TTTCATGATG TTTCGCCAGG CATAAAATAA
GTTCTATGTC TGTACATATT TTGCAGGCTT ACAAGAAATG GATCTTGAAG ACAATTGAAG ATTCATGGAA TTTTTTCCAC
AAGAAGTTTG TCGAATTATG GAATAAACAC AAAGATGGGA ATGGGGAAGC ATACCTGCCC CCTATATACA ACAGCTCAGA
GCTTTTGAGC CTTGTACAGA AGAAGTACAT GACAAGCCTA TTTCATGACA GTCTTGGATT TGGTTCAGCA AAAATGATCA
GGTAATTAAA CAGTACAATT ATGTAGAGTC TGTACTACTA AGTCAATTTG CTGAATCTTA TTTACGTCTA GACTATGAAG
ATATACTAGA CCTGCCCTTT TTAAATGTAA GAAGCTCAAA GGCACAGTAA GTTAGTCCAA AGTAGAGGTT TCCGATGCCA
ATTTTGATGC AGCACTTCTT TTTCATAAAT GTATATCAGT ATGTGCTATC CTAAAAGAGA TGTTCCAGAA GACCACCTTT
GACGATTATA AGTATGACTG AAAACCGTCA TAAATGGTTA AATTGGAGGC TATTCAGGAT ATTATGTTGT GAGAAGCTAA
GTGTAAAGAA CTTAAAATCA CATTTAAACG CCATTTTCAA ATTTTTTATC TGTGTTCCGA TGCCTTGTGC ATGATCCTCA
CGCGACTTCT GTTTACTAAA TTGGACCATA CATATGTAGG AGAATTGTTG GAATTGCTCA TGTTGAGGAT TTTGAGTCGA
TTGAGGATGC CAGCAAGAGA GCTTCGTGTG AGCGACGTGC CCTTAATTGT GCAAAGGCAA TCCTGAAGGG AAGACGCCAG
TTTGAAAGCA TCGAGCAAGT GATTGTGCAT GTACAATCGT TTGATCGGGA CTGATAAGGC TAACCATCTA CACAACCTTT
CTGATTGAGG AGACAAAAGT TTTCATCTGT TTACCATCAG CGATTATCTG TGCCTATTAT AAAGCAGAAT TGGCC

Locus: Os04g0669900

Loading...

Locus: Os04g0669900

Loading...