Os04t0671200-01

Locus

Os04g0671200

Description

Polyamine oxidase, Seed germination

RAP-DB Gene Symbol Synonym(s)

PAO4, OsPAO4, OsAO1, AO1

RAP-DB Gene Name Synonym(s)

POLYAMINE OXIDASE 4, Polyamine oxidase 4, Amine oxidase 1

CGSNL Gene Symbol

PAO4

CGSNL Gene Name

POLYAMINE OXIDASE 4

Oryzabase Gene Symbol Synonym(s)

OsPAO4, OsAO1, AO1

Oryzabase Gene Name Synonym(s)

Polyamine oxidase 4, Amine oxidase 1

Transcript Evidence

AK070003

Protein Evidence

Q7XR46

Literature

PMID: 21796433

PMID: 27570530

Note

Manual Curation

September 21, 2016

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Flavin amine oxidase (IPR001613)

FAD/NAD(P)-binding domain (IPR023753)

NAD(P)-binding domain (IPR016040)

Amine oxidase (IPR002937)

Full-length cDNA

J023038N13 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0671200-01)

RiceXPro (AK070003)

Others

Oryzabase (11405)

KEGG (Os04t0671200-01)

Transcript

2062 bp

>Os04t0671200-01 Polyamine oxidase, Seed germination
GAGGATTTGGAGTTGAATTGTGGGGAGGGGGACCTCGCGGGTGTTGCCGGTTTGGAGCCC
AAGATAGGGTTATGAGCTGCTTCGCGGACCGCCGCTGCTACGCCGCCAGCCGCCGCCAGG
ACGGCCTCCTCGTGTTCATGTTCTTCATCTCGATTCCCATACGTACTAGTAGCAGTAGTA
GTAATAATTGTAATTCCAGTAGTAGTATTAGTAGTAATCTCCTGTAAGCGGAGTTCCTCC
TCGCGGCTGCGTGTACGGGGACGGGAGGACCTTCTTCCTCTTCGTGTTCATCTTCTTCTT
CTTCTTCCTCTCTTCCTTCGGCTTCGGCGCTGGCGGCTATGGATCCCAATAGCCTCAAAA
CTGGAGGCCTCTTGCTTCCGACCATTGAGAGGCAATGTGCTTCGCCTCCATCCGTCATCG
TGATCGGTGGGGGAATTTCAGGGGTTGCAGCAGCCCGTGCTCTCTCCAATGCTTCGTTTG
AGGTGACTGTTTTGGAGTCCAGAGATCGCGTAGGCGGTCGTGTCCATACCGATTACTCTT
TCGGATGCCCAATTGATATGGGAGCCTCATGGCTCCACGGCGTTTGTAATGAGAACTCCT
TGGCACCATTGATTGGCTATCTTGGGCTGAAATTATATCGCACTAGTGGCGACAACTCTG
TTCTGTATGATCATGATTTAGAAAGTTATGCACTCTTTGATAAGGCTGGCCATCAGGTCT
CAAAGGAGACAGTTGCTAAAGTTGAAGAAACATTTGAAAGAATTCTTGATGAGACAGTTA
AAGTGCGTGATGAGCAGGAACATGACATGCCCCTTCTACAGGCGATTTCACTTGTTCTTG
AGAGGCACCCCCATCTGAAGTTACAAGGGATAGATGATCAAGTCTTGCAATGGTGTGTCT
GTCGGCTTGAGGCATGGTTTGCTGCAGATGCTGATGAAATATCTCTGAAAAACTGGGATC
AGGAGCATGTTCTTACCGGTGGCCATGGTCTGATGGTGAACGGATACTATCCTATAATTC
AGGCTCTTGCACAAGGTCTAGATATCCGGCTTAATCAAAGGGTAACCAAAATTGCCCGCC
AATTCAATGGAGTGACAGTTACCACTGAAGATGGAACAAGTTACTCTGCCGATGCTTGCA
TCATTACAGTACCGCTCGGTGTGCTCAAGGCAAACATAATCAAGTTCGAGCCTGAGTTGC
CCTCATGGAAGAGCTCTGCAATCGCAGACCTTGGTGTCGGTATCGAGAACAAGATCGCCA
TGCACTTCGATACAGTCTTCTGGCCTAATGTTGAGGTGCTGGGAATGGTTGGCCCAACGC
CTAAAGCATGTGGGTACTTCCTGAACCTCCACAAGGCCACCGGCAATCCGGTCCTCGTCT
ACATGGCCGCCGGTAGATTTGCTCAAGAAGTGGAAAAACTGTCAGACAAGGAGGCCGTTG
ATCTGGTCATGTCTCACCTGAAGAAAATGCTACCTGACGCCACTGAACCTACGAAGTATT
TGGTTTCACGCTGGGGTTCTGACCCGAACTCGCTGGGTTCCTACTCGTGCGACCTGGTCG
GGAAGCCGGCCGACGTGTCGGCGCGGTTCGCCGCACCGGTGGAGAACCTCTACTTCGCCG
GCGAGGCGGCCAGCGCCGACCACTCGGGGTCCGTCCACGGCGCCTACTCGTCGGGGATCG
CCGCCGCCGATGAGTGCCGGAAGCGCATCCTGATGCAGAAGGGCATCCCTGACCTCGTCC
AGGTCAAGGCCTACGAGGAGATGGCCGGAGTCATTGCTCCCCTTCAGATTTGCAGGACCT
GAAAAAACTGAACCTGCTCCACCCTGCCATTGTCATGGAATCTGGATTGATTCAATTGCC
ATGCCTATGCCCTGGAATCTTGATGATTCAATCACTCATACAAGTTCAAGTTCATGTAGG
GGATTAACTGCATGAATCAAAATTATTAATTAATAATTATGTAATTGTCATGTTATTATT
GAATAAATAAATCGAGATCATGCTTGAGATCTTTGTACTGGGACACAGTTTCAATTAATT
AATGCTAGTAACAACCTTGGAG

CDS

1464 bp

>Os04t0671200-01 Polyamine oxidase, Seed germination
ATGGATCCCAATAGCCTCAAAACTGGAGGCCTCTTGCTTCCGACCATTGAGAGGCAATGT
GCTTCGCCTCCATCCGTCATCGTGATCGGTGGGGGAATTTCAGGGGTTGCAGCAGCCCGT
GCTCTCTCCAATGCTTCGTTTGAGGTGACTGTTTTGGAGTCCAGAGATCGCGTAGGCGGT
CGTGTCCATACCGATTACTCTTTCGGATGCCCAATTGATATGGGAGCCTCATGGCTCCAC
GGCGTTTGTAATGAGAACTCCTTGGCACCATTGATTGGCTATCTTGGGCTGAAATTATAT
CGCACTAGTGGCGACAACTCTGTTCTGTATGATCATGATTTAGAAAGTTATGCACTCTTT
GATAAGGCTGGCCATCAGGTCTCAAAGGAGACAGTTGCTAAAGTTGAAGAAACATTTGAA
AGAATTCTTGATGAGACAGTTAAAGTGCGTGATGAGCAGGAACATGACATGCCCCTTCTA
CAGGCGATTTCACTTGTTCTTGAGAGGCACCCCCATCTGAAGTTACAAGGGATAGATGAT
CAAGTCTTGCAATGGTGTGTCTGTCGGCTTGAGGCATGGTTTGCTGCAGATGCTGATGAA
ATATCTCTGAAAAACTGGGATCAGGAGCATGTTCTTACCGGTGGCCATGGTCTGATGGTG
AACGGATACTATCCTATAATTCAGGCTCTTGCACAAGGTCTAGATATCCGGCTTAATCAA
AGGGTAACCAAAATTGCCCGCCAATTCAATGGAGTGACAGTTACCACTGAAGATGGAACA
AGTTACTCTGCCGATGCTTGCATCATTACAGTACCGCTCGGTGTGCTCAAGGCAAACATA
ATCAAGTTCGAGCCTGAGTTGCCCTCATGGAAGAGCTCTGCAATCGCAGACCTTGGTGTC
GGTATCGAGAACAAGATCGCCATGCACTTCGATACAGTCTTCTGGCCTAATGTTGAGGTG
CTGGGAATGGTTGGCCCAACGCCTAAAGCATGTGGGTACTTCCTGAACCTCCACAAGGCC
ACCGGCAATCCGGTCCTCGTCTACATGGCCGCCGGTAGATTTGCTCAAGAAGTGGAAAAA
CTGTCAGACAAGGAGGCCGTTGATCTGGTCATGTCTCACCTGAAGAAAATGCTACCTGAC
GCCACTGAACCTACGAAGTATTTGGTTTCACGCTGGGGTTCTGACCCGAACTCGCTGGGT
TCCTACTCGTGCGACCTGGTCGGGAAGCCGGCCGACGTGTCGGCGCGGTTCGCCGCACCG
GTGGAGAACCTCTACTTCGCCGGCGAGGCGGCCAGCGCCGACCACTCGGGGTCCGTCCAC
GGCGCCTACTCGTCGGGGATCGCCGCCGCCGATGAGTGCCGGAAGCGCATCCTGATGCAG
AAGGGCATCCCTGACCTCGTCCAGGTCAAGGCCTACGAGGAGATGGCCGGAGTCATTGCT
CCCCTTCAGATTTGCAGGACCTGA

Protein

488 aa

>Os04t0671200-01 Polyamine oxidase, Seed germination
MDPNSLKTGGLLLPTIERQCASPPSVIVIGGGISGVAAARALSNASFEVTVLESRDRVGG
RVHTDYSFGCPIDMGASWLHGVCNENSLAPLIGYLGLKLYRTSGDNSVLYDHDLESYALF
DKAGHQVSKETVAKVEETFERILDETVKVRDEQEHDMPLLQAISLVLERHPHLKLQGIDD
QVLQWCVCRLEAWFAADADEISLKNWDQEHVLTGGHGLMVNGYYPIIQALAQGLDIRLNQ
RVTKIARQFNGVTVTTEDGTSYSADACIITVPLGVLKANIIKFEPELPSWKSSAIADLGV
GIENKIAMHFDTVFWPNVEVLGMVGPTPKACGYFLNLHKATGNPVLVYMAAGRFAQEVEK
LSDKEAVDLVMSHLKKMLPDATEPTKYLVSRWGSDPNSLGSYSCDLVGKPADVSARFAAP
VENLYFAGEAASADHSGSVHGAYSSGIAAADECRKRILMQKGIPDLVQVKAYEEMAGVIA
PLQICRT*

5'UTR

chr04:34242750..34243087 (- strand) : 338 bp

CDS

chr04:34242722..34242749 (- strand) : 28 bp

chr04:34242167..34242371 (- strand) : 205 bp

chr04:34241965..34242078 (- strand) : 114 bp

chr04:34241782..34241869 (- strand) : 88 bp

chr04:34241578..34241663 (- strand) : 86 bp

chr04:34241370..34241472 (- strand) : 103 bp

chr04:34241125..34241222 (- strand) : 98 bp

chr04:34240532..34240961 (- strand) : 430 bp

chr04:34240101..34240412 (- strand) : 312 bp

3'UTR

chr04:34239841..34240100 (- strand) : 260 bp

FASTA

>Os04t0671200-01 class=Sequence position=chr04:34239841..34243087 (- strand)
GAGGATTTGG AGTTGAATTG TGGGGAGGGG GACCTCGCGG GTGTTGCCGG TTTGGAGCCC AAGATAGGGT TATGAGCTGC
TTCGCGGACC GCCGCTGCTA CGCCGCCAGC CGCCGCCAGG ACGGCCTCCT CGTGTTCATG TTCTTCATCT CGATTCCCAT
ACGTACTAGT AGCAGTAGTA GTAATAATTG TAATTCCAGT AGTAGTATTA GTAGTAATCT CCTGTAAGCG GAGTTCCTCC
TCGCGGCTGC GTGTACGGGG ACGGGAGGAC CTTCTTCCTC TTCGTGTTCA TCTTCTTCTT CTTCTTCCTC TCTTCCTTCG
GCTTCGGCGC TGGCGGCTAT GGATCCCAAT AGCCTCAAAA CTGGAGGTAT GAATTATTCC CACTTTTTTG TAATTTTTTT
TTCTGAAATT TTATCTGGTA GGAGTACTTG GTAGTGGTGC GTCGTGAAAG GTGGGAATAT TTCCCATTGA TCATAGTATT
TTTAGAAATC TATCTATTGT ACTTTAGAAT TAAATTTTCC ACATAGGGAA GGTGATCATC ACACTTTAGA TTTTACAAGA
TTATTAGAAT TTATAATTCT AGTTGGGTAC AAATTGGTTA GTTAGTTGGT AACTTGGGTA TCTACAGTAT TATGTAGATT
AGTGAGCTTG ATGTTCAACG TGATTTCTCT CTCTTATGAT TCACATACCT GACAGTAAAA AACATTTTTT GTTCAGGCCT
CTTGCTTCCG ACCATTGAGA GGCAATGTGC TTCGCCTCCA TCCGTCATCG TGATCGGTGG GGGAATTTCA GGGGTTGCAG
CAGCCCGTGC TCTCTCCAAT GCTTCGTTTG AGGTGACTGT TTTGGAGTCC AGAGATCGCG TAGGCGGTCG TGTCCATACC
GATTACTCTT TCGGATGCCC AATTGATATG GGAGCCTCAT GGTCAGTCTC ACCCTGAATT GTTAGTGTGA GAAATTCACT
TTAGATTCTG TTCATACAAG CTTACTTACT GTTCATTCCA AAAATTCAGG CTCCACGGCG TTTGTAATGA GAACTCCTTG
GCACCATTGA TTGGCTATCT TGGGCTGAAA TTATATCGCA CTAGTGGCGA CAACTCTGTT CTGTATGATC ATGATTTAGA
AAGGTAATCT TTTAGCTCTT GATCTTACGC TTTTCTTTAC CGATCCGCAC AATCCTTGTT GATTCTTACA TCAACTCTGT
CAATTGATTC TGTTACAGTT ATGCACTCTT TGATAAGGCT GGCCATCAGG TCTCAAAGGA GACAGTTGCT AAAGTTGAAG
AAACATTTGA AAGAATTCTT GATGAGGTAC ATAATGAACT CATTTATACT TGGTACTTCT GGTGCCGTTT GAAGAGCATG
TTCAGTTCAC TATCTAATTT CTGTTGCATT AATGTTCCAA AAAAAATTTT CTGTTGCATT GCAGACAGTT AAAGTGCGTG
ATGAGCAGGA ACATGACATG CCCCTTCTAC AGGCGATTTC ACTTGTTCTT GAGAGGCACC CCCATCTGAA GTATGCACAT
TCTTGTACCA TGCTATCAAT TTACTCACAA CATACTTAAT AAATTCCTAG GATGCATCAT GAGAGGTTGA CTGATATGGT
TACCATTATT TGTAGGTTAC AAGGGATAGA TGATCAAGTC TTGCAATGGT GTGTCTGTCG GCTTGAGGCA TGGTTTGCTG
CAGATGCTGA TGAAATATCT CTGAAAAACT GGGATCAGGT TAGCTGAAAT CAGTCTATAT TAGCACACTG CACATTCTTA
TAGTGACATT AGTTTGCTTA GTGAAGGATA TTGGTAAATT ACATCGAATT GTTTGCCATC TTGCATAGTT AGTTACTTAT
GTTTGTATTC CTCTTAACTA TGCAGGAGCA TGTTCTTACC GGTGGCCATG GTCTGATGGT GAACGGATAC TATCCTATAA
TTCAGGCTCT TGCACAAGGT CTAGATATCC GGCTTAATCA AAGGTGTGTT CTTTTACCTC CCGAGCATAC AAACACAACA
ATTAATTTCA GCATACTGAA GTCCCTTTTT CAGTGTATTT TGGCTCCACA AAATTACTTG TCGTTTCACT TGTCAATATT
GCTAAACAGT TTTGCTTACT CGCTTTTGCT ACTGCTAAAT CTTCAGGGTA ACCAAAATTG CCCGCCAATT CAATGGAGTG
ACAGTTACCA CTGAAGATGG AACAAGTTAC TCTGCCGATG CTTGCATCAT TACAGTACCG CTCGGTGTGC TCAAGGCAAA
CATAATCAAG TTCGAGCCTG AGTTGCCCTC ATGGAAGAGC TCTGCAATCG CAGACCTTGG TGTCGGTATC GAGAACAAGA
TCGCCATGCA CTTCGATACA GTCTTCTGGC CTAATGTTGA GGTGCTGGGA ATGGTTGGCC CAACGCCTAA AGCATGTGGG
TACTTCCTGA ACCTCCACAA GGCCACCGGC AATCCGGTCC TCGTCTACAT GGCCGCCGGT AGATTTGCTC AAGAAGTGGA
AAAACTGTCA GACAAGGAGG CCGTTGATCT GGTCATGTCT CACCTGAAGA AAATGCTACC TGACGCCACT GAACCTGTGA
GTTTGCCATC TCAGATCATG GCCACAGTTA GTTCCATTTT CGAGTTCGCA TTATCTGAAT GAATTCGTTG TTCTTGCGAC
TGACAATTTG CACTTGTTGA TTTGTGTTAT TGCAGACGAA GTATTTGGTT TCACGCTGGG GTTCTGACCC GAACTCGCTG
GGTTCCTACT CGTGCGACCT GGTCGGGAAG CCGGCCGACG TGTCGGCGCG GTTCGCCGCA CCGGTGGAGA ACCTCTACTT
CGCCGGCGAG GCGGCCAGCG CCGACCACTC GGGGTCCGTC CACGGCGCCT ACTCGTCGGG GATCGCCGCC GCCGATGAGT
GCCGGAAGCG CATCCTGATG CAGAAGGGCA TCCCTGACCT CGTCCAGGTC AAGGCCTACG AGGAGATGGC CGGAGTCATT
GCTCCCCTTC AGATTTGCAG GACCTGAAAA AACTGAACCT GCTCCACCCT GCCATTGTCA TGGAATCTGG ATTGATTCAA
TTGCCATGCC TATGCCCTGG AATCTTGATG ATTCAATCAC TCATACAAGT TCAAGTTCAT GTAGGGGATT AACTGCATGA
ATCAAAATTA TTAATTAATA ATTATGTAAT TGTCATGTTA TTATTGAATA AATAAATCGA GATCATGCTT GAGATCTTTG
TACTGGGACA CAGTTTCAAT TAATTAATGC TAGTAACAAC CTTGGAG

Locus: Os04g0671200

Loading...

Locus: Os04g0671200

Loading...