Os04t0671200-02

Locus

Os04g0671200

Description

Similar to H0624F09.9 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PAO4

CGSNL Gene Name

POLYAMINE OXIDASE 4

Oryzabase Gene Symbol Synonym(s)

OsPAO4, OsAO1, AO1

Oryzabase Gene Name Synonym(s)

Polyamine oxidase 4, Amine oxidase 1

Transcript Evidence

AK106044 (DDBJ, Best hit)

Protein Evidence

Q258Y9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Amine oxidase (IPR002937)

Full-length cDNA

001-206-E04 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0671200-02)

RiceXPro (AK106044)

Others

Oryzabase (11405)

KEGG (Os04t0671200-02 (EC:1.-.-.-))

Transcript

1322 bp

>Os04t0671200-02 Similar to H0624F09.9 protein.
TTAAAGTGCGTGATGAGCAGGAACATGACATGCCCCTTCTACAGGCGATTTCACTTGTTC
TTGAGAGGCACCCCCATCTGAAGTTACAAGGGATAGATGATCAAGTCTTGCAATGGTGTG
TCTGTCGGCTTGAGGCATGGTTTGCTGCAGATGCTGATGAAATATCTCTGAAAAACTGGG
ATCAGGAGCATGTTCTTACCGGTGGCCATGGTCTGATGGTGAACGGATACTATCCTATAA
TTCAGGCTCTTGCACAAGGTCTAGATATCCGGCTTAATCAAAGGGTAACCAAAATTGCCC
GCCAATTCAATGGAGTGACAGTTACCACTGAAGATGGAACAAGTTACTCTGCCGATGCTT
GCATCATTACAGTACCGCTCGGTGTGCTCAAGGCAAACATAATCAAGTTCGAGCCTGAGT
TGCCCTCATGGAAGAGCTCTGCAATCGCAGACCTTGGTGTCGGTATCGAGAACAAGATCG
CCATGCACTTCGATACAGTCTTCTGGCCTAATGTTGAGGTGCTGGGAATGGTTGGCCCAA
CGCCTAAAGCATGTGGGTACTTCCTGAACCTCCACAAGGCCACCGGCAATCCGGTCCTCG
TCTACATGGCCGCCGGTAGATTTGCTCAAGAAGTGGAAAAACTGTCAGACAAGGAGGCCG
TTGATCTGGTCATGTCTCACCTGAAGAAAATGCTACCTGACGCCACTGAACCTACGAAGT
ATTTGGTTTCACGCTGGGGTTCTGACCCGAACTCGCTGGGTTCCTACTCGTGCGACCTGG
TCGGGAAGCCGGCCGACGTGTCGGCGCGGTTCGCCGCACCGGTGGAGAACCTCTACTTCG
CCGGCGAGGCGGCCAGCGCCGACCACTCGGGGTCCGTCCACGGCGCCTACTCGTCGGGGA
TCGCCGCCGCCGATGAGTGCCGGAAGCGCATCCTGATGCAGAAGGGCATCCCTGACCTCG
TCCAGGTCAAGGCCTACGAGGAGATGGCCGGAGTCATTGCTCCCCTTCAGATTTGCAGGA
CCTGAAAAAACTGAACCTGCTCCACCCTGCCATTGTCATGGAATCTGGATTGATTCAATT
GCCATGCCTATGCCCTGGAATCTTGATGATTCAATCACTCATACAAGTTCAAGTTCATGT
AGGGGATTAACTGCATGAATCAAAATTATTAATTAATAATTATGTAATTGTCATGTTATT
ATTGAATAAATAAATCGAGATCATGCTTGAGATCTTTGTACTGGGACACAGTTTCAATTA
ATTAATGCTAGTAACAACCTTGGAGTGAATGAATGTGAGTAGTTGGGCTGGAGTTGCTTG
TT

CDS

1023 bp

>Os04t0671200-02 Similar to H0624F09.9 protein.
AAAGTGCGTGATGAGCAGGAACATGACATGCCCCTTCTACAGGCGATTTCACTTGTTCTT
GAGAGGCACCCCCATCTGAAGTTACAAGGGATAGATGATCAAGTCTTGCAATGGTGTGTC
TGTCGGCTTGAGGCATGGTTTGCTGCAGATGCTGATGAAATATCTCTGAAAAACTGGGAT
CAGGAGCATGTTCTTACCGGTGGCCATGGTCTGATGGTGAACGGATACTATCCTATAATT
CAGGCTCTTGCACAAGGTCTAGATATCCGGCTTAATCAAAGGGTAACCAAAATTGCCCGC
CAATTCAATGGAGTGACAGTTACCACTGAAGATGGAACAAGTTACTCTGCCGATGCTTGC
ATCATTACAGTACCGCTCGGTGTGCTCAAGGCAAACATAATCAAGTTCGAGCCTGAGTTG
CCCTCATGGAAGAGCTCTGCAATCGCAGACCTTGGTGTCGGTATCGAGAACAAGATCGCC
ATGCACTTCGATACAGTCTTCTGGCCTAATGTTGAGGTGCTGGGAATGGTTGGCCCAACG
CCTAAAGCATGTGGGTACTTCCTGAACCTCCACAAGGCCACCGGCAATCCGGTCCTCGTC
TACATGGCCGCCGGTAGATTTGCTCAAGAAGTGGAAAAACTGTCAGACAAGGAGGCCGTT
GATCTGGTCATGTCTCACCTGAAGAAAATGCTACCTGACGCCACTGAACCTACGAAGTAT
TTGGTTTCACGCTGGGGTTCTGACCCGAACTCGCTGGGTTCCTACTCGTGCGACCTGGTC
GGGAAGCCGGCCGACGTGTCGGCGCGGTTCGCCGCACCGGTGGAGAACCTCTACTTCGCC
GGCGAGGCGGCCAGCGCCGACCACTCGGGGTCCGTCCACGGCGCCTACTCGTCGGGGATC
GCCGCCGCCGATGAGTGCCGGAAGCGCATCCTGATGCAGAAGGGCATCCCTGACCTCGTC
CAGGTCAAGGCCTACGAGGAGATGGCCGGAGTCATTGCTCCCCTTCAGATTTGCAGGACC
TGA

Protein

341 aa

>Os04t0671200-02 Similar to H0624F09.9 protein.
KVRDEQEHDMPLLQAISLVLERHPHLKLQGIDDQVLQWCVCRLEAWFAADADEISLKNWD
QEHVLTGGHGLMVNGYYPIIQALAQGLDIRLNQRVTKIARQFNGVTVTTEDGTSYSADAC
IITVPLGVLKANIIKFEPELPSWKSSAIADLGVGIENKIAMHFDTVFWPNVEVLGMVGPT
PKACGYFLNLHKATGNPVLVYMAAGRFAQEVEKLSDKEAVDLVMSHLKKMLPDATEPTKY
LVSRWGSDPNSLGSYSCDLVGKPADVSARFAAPVENLYFAGEAASADHSGSVHGAYSSGI
AAADECRKRILMQKGIPDLVQVKAYEEMAGVIAPLQICRT*

5'UTR

chr04:34241658..34241659 (- strand) : 2 bp

CDS

chr04:34241578..34241657 (- strand) : 80 bp

chr04:34241370..34241472 (- strand) : 103 bp

chr04:34241125..34241222 (- strand) : 98 bp

chr04:34240532..34240961 (- strand) : 430 bp

chr04:34240101..34240412 (- strand) : 312 bp

3'UTR

chr04:34239804..34240100 (- strand) : 297 bp

FASTA

>Os04t0671200-02 class=Sequence position=chr04:34239804..34241659 (- strand)
TTAAAGTGCG TGATGAGCAG GAACATGACA TGCCCCTTCT ACAGGCGATT TCACTTGTTC TTGAGAGGCA CCCCCATCTG
AAGTATGCAC ATTCTTGTAC CATGCTATCA ATTTACTCAC AACATACTTA ATAAATTCCT AGGATGCATC ATGAGAGGTT
GACTGATATG GTTACCATTA TTTGTAGGTT ACAAGGGATA GATGATCAAG TCTTGCAATG GTGTGTCTGT CGGCTTGAGG
CATGGTTTGC TGCAGATGCT GATGAAATAT CTCTGAAAAA CTGGGATCAG GTTAGCTGAA ATCAGTCTAT ATTAGCACAC
TGCACATTCT TATAGTGACA TTAGTTTGCT TAGTGAAGGA TATTGGTAAA TTACATCGAA TTGTTTGCCA TCTTGCATAG
TTAGTTACTT ATGTTTGTAT TCCTCTTAAC TATGCAGGAG CATGTTCTTA CCGGTGGCCA TGGTCTGATG GTGAACGGAT
ACTATCCTAT AATTCAGGCT CTTGCACAAG GTCTAGATAT CCGGCTTAAT CAAAGGTGTG TTCTTTTACC TCCCGAGCAT
ACAAACACAA CAATTAATTT CAGCATACTG AAGTCCCTTT TTCAGTGTAT TTTGGCTCCA CAAAATTACT TGTCGTTTCA
CTTGTCAATA TTGCTAAACA GTTTTGCTTA CTCGCTTTTG CTACTGCTAA ATCTTCAGGG TAACCAAAAT TGCCCGCCAA
TTCAATGGAG TGACAGTTAC CACTGAAGAT GGAACAAGTT ACTCTGCCGA TGCTTGCATC ATTACAGTAC CGCTCGGTGT
GCTCAAGGCA AACATAATCA AGTTCGAGCC TGAGTTGCCC TCATGGAAGA GCTCTGCAAT CGCAGACCTT GGTGTCGGTA
TCGAGAACAA GATCGCCATG CACTTCGATA CAGTCTTCTG GCCTAATGTT GAGGTGCTGG GAATGGTTGG CCCAACGCCT
AAAGCATGTG GGTACTTCCT GAACCTCCAC AAGGCCACCG GCAATCCGGT CCTCGTCTAC ATGGCCGCCG GTAGATTTGC
TCAAGAAGTG GAAAAACTGT CAGACAAGGA GGCCGTTGAT CTGGTCATGT CTCACCTGAA GAAAATGCTA CCTGACGCCA
CTGAACCTGT GAGTTTGCCA TCTCAGATCA TGGCCACAGT TAGTTCCATT TTCGAGTTCG CATTATCTGA ATGAATTCGT
TGTTCTTGCG ACTGACAATT TGCACTTGTT GATTTGTGTT ATTGCAGACG AAGTATTTGG TTTCACGCTG GGGTTCTGAC
CCGAACTCGC TGGGTTCCTA CTCGTGCGAC CTGGTCGGGA AGCCGGCCGA CGTGTCGGCG CGGTTCGCCG CACCGGTGGA
GAACCTCTAC TTCGCCGGCG AGGCGGCCAG CGCCGACCAC TCGGGGTCCG TCCACGGCGC CTACTCGTCG GGGATCGCCG
CCGCCGATGA GTGCCGGAAG CGCATCCTGA TGCAGAAGGG CATCCCTGAC CTCGTCCAGG TCAAGGCCTA CGAGGAGATG
GCCGGAGTCA TTGCTCCCCT TCAGATTTGC AGGACCTGAA AAAACTGAAC CTGCTCCACC CTGCCATTGT CATGGAATCT
GGATTGATTC AATTGCCATG CCTATGCCCT GGAATCTTGA TGATTCAATC ACTCATACAA GTTCAAGTTC ATGTAGGGGA
TTAACTGCAT GAATCAAAAT TATTAATTAA TAATTATGTA ATTGTCATGT TATTATTGAA TAAATAAATC GAGATCATGC
TTGAGATCTT TGTACTGGGA CACAGTTTCA ATTAATTAAT GCTAGTAACA ACCTTGGAGT GAATGAATGT GAGTAGTTGG
GCTGGAGTTG CTTGTT

Locus: Os04g0671200

Loading...

Locus: Os04g0671200

Loading...