Os04t0671300-01

Locus

Os04g0671300

Description

Polyamine oxidase, Seed germination

RAP-DB Gene Symbol Synonym(s)

PAO5, OsPAO5, OsAO2, AO2

RAP-DB Gene Name Synonym(s)

POLYAMINE OXIDASE 5, Polyamine oxidase 5, Amine oxidase 2

CGSNL Gene Symbol

PAO5

CGSNL Gene Name

POLYAMINE OXIDASE 5

Oryzabase Gene Symbol Synonym(s)

OsPAO5, OsAO2, AO2

Oryzabase Gene Name Synonym(s)

Polyamine oxidase 5, Amine oxidase 2

Transcript Evidence

AK072414

Protein Evidence

Q0J954

Literature

PMID: 21796433

PMID: 27570530

Note

Manual Curation

September 21, 2016

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Flavin amine oxidase (IPR001613)

NAD(P)-binding domain (IPR016040)

FAD/NAD(P)-binding domain (IPR023753)

Amine oxidase (IPR002937)

Full-length cDNA

J023083K01 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0671300-01)

RiceXPro (AK072414)

Others

Oryzabase (11406)

KEGG (Os04t0671300-01)

Transcript

2112 bp

>Os04t0671300-01 Polyamine oxidase, Seed germination
ACCGCATCATCGGCTTCCCTCCGGCTCGAGCCAATCTCTCGCTGTGTCTCTCTCGCGCTC
TCCACTAGCACCGGCTCGGCTCGGCTCGCGCGGCGGCGGCGGCGGGGCGGCGTGGCGCCG
AGGGAGGGGAACGCCGGTGTGGGGAGGGCGGCGGCGAGGGGACTCGCCGGCGACGAGCTG
GTTTGGGTATGAGAGGGGTTACCCATGCGGCGCCGACCACGAGCGTCCCCCGCCGCGGCT
CCATGGACGGCCTCCTCATCTTCGTCTTCTACCTCTCGCTTCCTATACGTGGTGGCCGCG
ACCACTCGTTAATCTCCTCCTCTAATTGTTAGCCGATCTCGCCTCTCCCCCACACTCTCT
GATCCCGCTCTCTCTCTCTGCTTCGATTCGATTCGATTCGATCTTCTCCACCTCGTCGCC
GTCGAACGCAACTCGGATCGGGAGGATAATGGACCAGCCTTCTAATGGCTTCGCCGCCGG
AGGTCTTTTTCTTCGTCACATTGATGGGCAAAATGCCTCTCCCCCTTCTGTCATTGTGAT
TGGTGGAGGGATTTCAGGCATTGCAGCTGCTCGTGCGCTGTCTAATGCTTCGTTTAAGGT
CACACTATTAGAGTCACGGGACCGACTTGGTGGCCGTGTGCATACTGACTATTCTTTTGG
CTGCCCAATTGACATGGGAGCATCTTGGTTGCATGGTGTATGCAATGAGAATTCATTGGC
ACCACTGATTAGGTTGCTTGGCCTTAGATTATATCGCACCAGTGGTGATAACTCTGTGCT
ATATGACCATGATCTGGAGAGCTATGCTCTCTTTGATAAGGATGGTCGTCAAGTTCCCCA
GGAGATAGTGACAAAAGTCGGGGAAACATTTGAGAAAATTCTTAAGGAGACGGTGAAAGT
AAGAGCTGAACATGAAGATGACATGCCTCTTATTCAAGCCATCTCAATTGTGCTTGACAG
GAATCCACACCTAAAGCTTGATGGTTTGCAATATGAAGTACTGCAGTGGTGCATATGTAG
GCTGGAGGCATGGTTTGCCACAGATGTGGATAATATATCTCTGAAAAATTGGGATCAGGA
ACATGTTCTTACTGGTGGCCATGGGCTTATGGTGCATGGTTATGATCCTGTTATCAAAGC
TCTCGCGCAAGATCTTGATATCCACCTGAACCACAGGGTTACCAAAATCATCCAGAGGTA
CAACAAAACTATAGTATGTGTTGAAGATGGGACAAGCTTTGTTGCAGATGCTGCTATAAT
AACTGTCCCTCTTGGTGTACTTAAAGCAAATATCATCAAGTTTGAACCTGAGCTCCCAGA
TTGGAAGCTTTCATCAATATCTGATCTTGGTATTGGCATTGAGAACAAAATAGCCCTCCG
CTTCAATAGTGTATTTTGGCCAAATGTAGAAGTGCTAGGCAGGGTTGCCCCAACATCAAA
TGCCTGCGGTTACTTTCTTAACCTTCACAAAGCCACAGGGCATCCGGTTCTTGTATGCAT
GGTAGCAGGAAGATTCGCATATGAATTCGAGAAGCTATCCGATGAAGAATCCGTAAACTT
TGTCATGTCTCAGCTCAAGAAAATGCTACCAGGAGCTACTGAACCGGTCCAGTATTTGGT
TTCAAGGTGGGGAACCGACCCGAATTCGCTTGGTTCTTATTCCTGCGACCTTGTTGGGAA
GCCAGCTGACTTGTATGAAAGATTCTGTGCTCCGGTGGGCAACCTGTTTTTCGCTGGGGA
GGCCGCCTGCATCGATCACTCTGGGTCCGTGCATGGAGCTTATTCTTCAGGCATTGTTGC
TGCAGAGGATTGCCGAAGGCATCTGTCGACGCAGCTAGGCATCTCCGACCTTTTCCAGGT
TGGGAAGATTATCATGAGGGAGGAGATGACTGAAGTCATGGTCCCCTTCCAGATATCCAG
GCTGTGAAAGAAGAACAAAGCCTGCCTATTTAGCACCGTGTTTATCCTGCAGCTGCTATG
GTTAATATTGTAGCTGCTGCTCTGTAGTTTCCTAATTATCTCAGATCCTGTACCGTTTCA
CAGTTTGATCGTTTATGTGTATTCAAATAAAAACAGAATAATTATATATCAACAGACCTT
GTTCTCTGAATC

CDS

1479 bp

>Os04t0671300-01 Polyamine oxidase, Seed germination
ATGGACCAGCCTTCTAATGGCTTCGCCGCCGGAGGTCTTTTTCTTCGTCACATTGATGGG
CAAAATGCCTCTCCCCCTTCTGTCATTGTGATTGGTGGAGGGATTTCAGGCATTGCAGCT
GCTCGTGCGCTGTCTAATGCTTCGTTTAAGGTCACACTATTAGAGTCACGGGACCGACTT
GGTGGCCGTGTGCATACTGACTATTCTTTTGGCTGCCCAATTGACATGGGAGCATCTTGG
TTGCATGGTGTATGCAATGAGAATTCATTGGCACCACTGATTAGGTTGCTTGGCCTTAGA
TTATATCGCACCAGTGGTGATAACTCTGTGCTATATGACCATGATCTGGAGAGCTATGCT
CTCTTTGATAAGGATGGTCGTCAAGTTCCCCAGGAGATAGTGACAAAAGTCGGGGAAACA
TTTGAGAAAATTCTTAAGGAGACGGTGAAAGTAAGAGCTGAACATGAAGATGACATGCCT
CTTATTCAAGCCATCTCAATTGTGCTTGACAGGAATCCACACCTAAAGCTTGATGGTTTG
CAATATGAAGTACTGCAGTGGTGCATATGTAGGCTGGAGGCATGGTTTGCCACAGATGTG
GATAATATATCTCTGAAAAATTGGGATCAGGAACATGTTCTTACTGGTGGCCATGGGCTT
ATGGTGCATGGTTATGATCCTGTTATCAAAGCTCTCGCGCAAGATCTTGATATCCACCTG
AACCACAGGGTTACCAAAATCATCCAGAGGTACAACAAAACTATAGTATGTGTTGAAGAT
GGGACAAGCTTTGTTGCAGATGCTGCTATAATAACTGTCCCTCTTGGTGTACTTAAAGCA
AATATCATCAAGTTTGAACCTGAGCTCCCAGATTGGAAGCTTTCATCAATATCTGATCTT
GGTATTGGCATTGAGAACAAAATAGCCCTCCGCTTCAATAGTGTATTTTGGCCAAATGTA
GAAGTGCTAGGCAGGGTTGCCCCAACATCAAATGCCTGCGGTTACTTTCTTAACCTTCAC
AAAGCCACAGGGCATCCGGTTCTTGTATGCATGGTAGCAGGAAGATTCGCATATGAATTC
GAGAAGCTATCCGATGAAGAATCCGTAAACTTTGTCATGTCTCAGCTCAAGAAAATGCTA
CCAGGAGCTACTGAACCGGTCCAGTATTTGGTTTCAAGGTGGGGAACCGACCCGAATTCG
CTTGGTTCTTATTCCTGCGACCTTGTTGGGAAGCCAGCTGACTTGTATGAAAGATTCTGT
GCTCCGGTGGGCAACCTGTTTTTCGCTGGGGAGGCCGCCTGCATCGATCACTCTGGGTCC
GTGCATGGAGCTTATTCTTCAGGCATTGTTGCTGCAGAGGATTGCCGAAGGCATCTGTCG
ACGCAGCTAGGCATCTCCGACCTTTTCCAGGTTGGGAAGATTATCATGAGGGAGGAGATG
ACTGAAGTCATGGTCCCCTTCCAGATATCCAGGCTGTGA

Protein

493 aa

>Os04t0671300-01 Polyamine oxidase, Seed germination
MDQPSNGFAAGGLFLRHIDGQNASPPSVIVIGGGISGIAAARALSNASFKVTLLESRDRL
GGRVHTDYSFGCPIDMGASWLHGVCNENSLAPLIRLLGLRLYRTSGDNSVLYDHDLESYA
LFDKDGRQVPQEIVTKVGETFEKILKETVKVRAEHEDDMPLIQAISIVLDRNPHLKLDGL
QYEVLQWCICRLEAWFATDVDNISLKNWDQEHVLTGGHGLMVHGYDPVIKALAQDLDIHL
NHRVTKIIQRYNKTIVCVEDGTSFVADAAIITVPLGVLKANIIKFEPELPDWKLSSISDL
GIGIENKIALRFNSVFWPNVEVLGRVAPTSNACGYFLNLHKATGHPVLVCMVAGRFAYEF
EKLSDEESVNFVMSQLKKMLPGATEPVQYLVSRWGTDPNSLGSYSCDLVGKPADLYERFC
APVGNLFFAGEAACIDHSGSVHGAYSSGIVAAEDCRRHLSTQLGISDLFQVGKIIMREEM
TEVMVPFQISRL*

5'UTR

chr04:34247876..34248323 (- strand) : 448 bp

CDS

chr04:34247842..34247875 (- strand) : 34 bp

chr04:34246561..34246676 (- strand) : 116 bp

chr04:34246339..34246427 (- strand) : 89 bp

chr04:34246142..34246255 (- strand) : 114 bp

chr04:34245970..34246057 (- strand) : 88 bp

chr04:34245801..34245886 (- strand) : 86 bp

chr04:34245607..34245709 (- strand) : 103 bp

chr04:34245417..34245514 (- strand) : 98 bp

chr04:34244877..34245306 (- strand) : 430 bp

chr04:34244458..34244778 (- strand) : 321 bp

3'UTR

chr04:34244273..34244457 (- strand) : 185 bp

FASTA

>Os04t0671300-01 class=Sequence position=chr04:34244273..34248323 (- strand)
ACCGCATCAT CGGCTTCCCT CCGGCTCGAG CCAATCTCTC GCTGTGTCTC TCTCGCGCTC TCCACTAGCA CCGGCTCGGC
TCGGCTCGCG CGGCGGCGGC GGCGGGGCGG CGTGGCGCCG AGGGAGGGGA ACGCCGGTGT GGGGAGGGCG GCGGCGAGGG
GACTCGCCGG CGACGAGCTG GTTTGGGTAT GAGAGGGGTT ACCCATGCGG CGCCGACCAC GAGCGTCCCC CGCCGCGGCT
CCATGGACGG CCTCCTCATC TTCGTCTTCT ACCTCTCGCT TCCTATACGT GGTGGCCGCG ACCACTCGTT AATCTCCTCC
TCTAATTGTT AGCCGATCTC GCCTCTCCCC CACACTCTCT GATCCCGCTC TCTCTCTCTG CTTCGATTCG ATTCGATTCG
ATCTTCTCCA CCTCGTCGCC GTCGAACGCA ACTCGGATCG GGAGGATAAT GGACCAGCCT TCTAATGGCT TCGCCGCCGG
AGGTGCGTCT CCGATCAGAA TACTCCCCTG TTCTTTTTTT TCCATTTTTA GGTAGAGAAG TCATTTTTTA TTTTATTATT
TTTTTGCAAA TTGATATGTT CATCAGTGCT ATTCAATTTC AACCATGCAT ACAAATCCCA CACGCAACTT TAGATTACTA
TCCAAGTATA AAATCCAAGT TGATTGTGTT ACGGCAAATA TTGCTGTCGA CCTGTCGTGG ACTGGCGTCC CAATCGCAAT
CGATTGTGTG AGTATGACAG TGCAGTGCTT TAGTGTCACA AATCGTAGGG GTCAGAATGT TTCGATTCAG TAAATGCTGA
TATGGAGCCA TCCTTTTTTT TCTTTTTTTT TTTGGTTCCG GTGAATACGC AAAAGGGGTT GCGTAGCCAT GGATTAAGGT
GGTGAAAGCA AAGCTAAAAT CCTATCGAAT ATGAAATGTG TACATATCTT TAACTTTATA CCTTTTTTGT TCTATGTAAT
AATTATATAA ATACATAAAG TAGGACCCTT CATTACTGTT TTCTTTTTTA AAAAACGAAA TGTTGTAAAA CGATCCTTTA
ATTGATTGGG GACCATCCCC CATTGTTTTA AATCTTGCAA TATCAGATGA GTCACAGTAG TGTAGATACC ATCAATCAGC
AAGAATCTAG AGGAAAGGAA GGGATTGTGA TGGCAATTTG CTAGCAAAAC TGTGAAAGAG ATGTGGAACA AGGTTCCAAA
AATTGAGGTC TCTAAAAGAG TAAAAGGTCA ATAGGAAAAA AATGGTATCC CTTGTCCAGA AGAAGTAGCA TCCGAGGCCG
AATTGTTTCC TTGTTCTTGA TTGCATTTTT TGCAGAATAT GCTGCTGCAT CGATTAATCC AGACTGCTCT GCGTCAAATA
ACTCTATGGA TCATTCTGCT CAATCTAATT CGAACATGAC ACTTTATTGC CAAAAACCAA CTGTAATGAA TAAATCACTA
ACAAAGATTA TTCAGTTGGC CACTTGTGGG CTCGAAAGCA CAACTATTTT CAGTCATAAA TTTAACAAAT GACACATGGT
TGCACTGAAT GAAACTTTAA ATGTGCTTAT TCATGTACAT GTTTGAGAAA TATGTGATAT TAGTTGAGCT ACAATTCCAA
ATTGATTTCA ATATTTAACC CAGAAATTTA CTGTGCGGTG CATTCAGGTC TTTTTCTTCG TCACATTGAT GGGCAAAATG
CCTCTCCCCC TTCTGTCATT GTGATTGGTG GAGGGATTTC AGGCATTGCA GCTGCTCGTG CGCTGTCTAA TGCTTCGTTT
AAGGTAAATG CTGTCATTGA AAGATGAAAT AACTATATCT CTGTCTTCTA TATTCTATTA GCTTATTGTC CAAAAATAAG
TTAATGTTTT GATGCTTCCC GGGCCCTTTT TCTTAGATAC TTTTACATAA CTACAGGTCA CACTATTAGA GTCACGGGAC
CGACTTGGTG GCCGTGTGCA TACTGACTAT TCTTTTGGCT GCCCAATTGA CATGGGAGCA TCTTGGTTAG TTGCATCCCA
GAAGTAGCTA TTTTCGCCGC CTTGCAACGT GTTTGGTTTT CATCTCATGG TTTTATCATG TGGTTCAGGT TGCATGGTGT
ATGCAATGAG AATTCATTGG CACCACTGAT TAGGTTGCTT GGCCTTAGAT TATATCGCAC CAGTGGTGAT AACTCTGTGC
TATATGACCA TGATCTGGAG AGGTTAGGAG TTATTCCTAA CCCATAAGTT TATCCTCAAC TTGATGGGCT TTCATTCTCT
TACAATTGTT GTTTTTGTTC ATTTAGCTAT GCTCTCTTTG ATAAGGATGG TCGTCAAGTT CCCCAGGAGA TAGTGACAAA
AGTCGGGGAA ACATTTGAGA AAATTCTTAA GGAGGTATTG TCATCGTTTG CATTTCATTT GTTATCCATC AAATGCTTTT
ATGCAACTCT TGTGAGCTTA CTTTGTTAAT ATTGCAGACG GTGAAAGTAA GAGCTGAACA TGAAGATGAC ATGCCTCTTA
TTCAAGCCAT CTCAATTGTG CTTGACAGGA ATCCACACCT AAAGTAAGTG GAATTTAGCA TTCACCTATA TCTGGAATGG
TGGTGCTTTA GCGACGGGGT GAAATGTTCT AATGATATGC ATTCACTCTT ACAGGCTTGA TGGTTTGCAA TATGAAGTAC
TGCAGTGGTG CATATGTAGG CTGGAGGCAT GGTTTGCCAC AGATGTGGAT AATATATCTC TGAAAAATTG GGATCAGGTA
TGCAATAGGG GGCACTTTTG TATTTACATG CGCACATGAA GAATTGTTGT ATTCACGTAG AGCAGTGGAC TGACCTTTCA
AATTTACAGG AACATGTTCT TACTGGTGGC CATGGGCTTA TGGTGCATGG TTATGATCCT GTTATCAAAG CTCTCGCGCA
AGATCTTGAT ATCCACCTGA ACCACAGGTA TGCAGTTACA TATCCTCATG GCCAAGTAAT TCACATAAGT TCTGTTTCAT
AGGTTTCATA GTTATAATCC CAAATCTATA GTATCTTATC TCTTAACTTT CCTCCAGGGT TACCAAAATC ATCCAGAGGT
ACAACAAAAC TATAGTATGT GTTGAAGATG GGACAAGCTT TGTTGCAGAT GCTGCTATAA TAACTGTCCC TCTTGGTGTA
CTTAAAGCAA ATATCATCAA GTTTGAACCT GAGCTCCCAG ATTGGAAGCT TTCATCAATA TCTGATCTTG GTATTGGCAT
TGAGAACAAA ATAGCCCTCC GCTTCAATAG TGTATTTTGG CCAAATGTAG AAGTGCTAGG CAGGGTTGCC CCAACATCAA
ATGCCTGCGG TTACTTTCTT AACCTTCACA AAGCCACAGG GCATCCGGTT CTTGTATGCA TGGTAGCAGG AAGATTCGCA
TATGAATTCG AGAAGCTATC CGATGAAGAA TCCGTAAACT TTGTCATGTC TCAGCTCAAG AAAATGCTAC CAGGAGCTAC
TGAACCGGTA AATCCTCAAA ATTCATTTTC AGACCATGTA CAGTTGAGTA CTGTCAATTT CAGACTATGA ACAGTAGCTC
TAACACTTGT GCTACACAAC TGCAGGTCCA GTATTTGGTT TCAAGGTGGG GAACCGACCC GAATTCGCTT GGTTCTTATT
CCTGCGACCT TGTTGGGAAG CCAGCTGACT TGTATGAAAG ATTCTGTGCT CCGGTGGGCA ACCTGTTTTT CGCTGGGGAG
GCCGCCTGCA TCGATCACTC TGGGTCCGTG CATGGAGCTT ATTCTTCAGG CATTGTTGCT GCAGAGGATT GCCGAAGGCA
TCTGTCGACG CAGCTAGGCA TCTCCGACCT TTTCCAGGTT GGGAAGATTA TCATGAGGGA GGAGATGACT GAAGTCATGG
TCCCCTTCCA GATATCCAGG CTGTGAAAGA AGAACAAAGC CTGCCTATTT AGCACCGTGT TTATCCTGCA GCTGCTATGG
TTAATATTGT AGCTGCTGCT CTGTAGTTTC CTAATTATCT CAGATCCTGT ACCGTTTCAC AGTTTGATCG TTTATGTGTA
TTCAAATAAA AACAGAATAA TTATATATCA ACAGACCTTG TTCTCTGAAT C

Locus: Os04g0671300

Loading...

Locus: Os04g0671300

Loading...