Os04t0671700-01

Locus

Os04g0671700

Description

ThiJ/PfpI domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDJ-1C, DJ-1C, OsDJ-1C.1, OsDJ-1C.2, OsDJ-1C.3

Oryzabase Gene Name Synonym(s)

DJ-1/PfpI domain containing protein C, DJ-1 protein C

Transcript Evidence

AK100753 (DDBJ, Best hit)

Protein Evidence

NP_001146927.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: hydrolase activity, acting on glycosyl bonds (GO:0016798)

Functional domain (InterPro)

ThiJ/PfpI (IPR002818)

Peptidase C56, PfpI (IPR006286)

Full-length cDNA

J023118M23 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0671700-01)

RiceXPro (AK100753)

Others

Oryzabase (20914)

KEGG (Os04t0671700-01)

Transcript

1367 bp

>Os04t0671700-01 ThiJ/PfpI domain containing protein.
AGTCTCTCGGCTTCTAGACTAGGGAAGCTCACCAACCCAAGAACAAGAAGTGATCGGAGA
TGGCTCCCAAGAAGGTGCTCCTGCTCTGCGGAGACTACATGGAGGACTACGAGGCCATGG
TTCCGTTCCAAGCGCTGCAAGCGTACGGGGTGTCCGTGGATGCTGCCTGCCCCGGCAAGA
AGGCCGGCGACTCGTGCCGCACCGCCGTCCATCAGGGGATTGGCCACCAGACATATGCTG
AGTCAAGGGGCCACAATTTCGCACTTAATGCTTCGTTTGATGAGGTTAATATCAATGAAT
ATGATGGCTTGGTAATTCCTGGAGGCCGTGCACCAGAGTATCTCGCCATGGATGAAAAGG
TTCTTGATTTAGTAAGGAAATTCTCTGATGCGAAGAAACCTATTGCATCAGTTTGCCATG
GACAGTTGATTTTGGCAGCAGCTGGAGTAGTCCAGAACCGTAAATGCACCGCATATCCTG
CTGTTAAACCAGTTTTGGTTGCTGCTGGTGCTAAGTGGGAAGAAGCTGATACTATGGACA
AATGCACAGTTGATGGAAATCTTGTCACTGCAGTGGCTTACGATGCACATCCTGAATTCA
TCAGCCTTTTTGTGAAAGCGCTTGGAGGCTCTGTAACTGGCTCAAACAAACGGATATTGT
TCCTTTGTGGGGATTACATGGAAGATTATGAGGTTATGGTACCATTTCAGTCTCTTCAAG
CCCTTGGTTGCCATGTTGATGCAGTTTGCCCTGACAAGGGTGCTGGGGAGAAATGCCCAA
CTGCCATACATGACTTTGAAGGTGACCAAACATACAGCGAGAAGCCTGGTCACGATTTTG
CTTTGACAGCATCATTTGACAATGTGGATGCATCAAGCTATGATGCACTTGTAATTCCTG
GTGGACGGGCTCCTGAGTACCTTGCACTGAACGATAAAGTCATTAGCCTTGTGAAGGGCT
TCATGGATAAAGCAAAGCCAGTCGCCTCAATTTGCCATGGCCAACAGATTTTATCTGCTG
CTGGAGTCCTTCAGGGAAGGAAATGCACGGCGTATCCTGCGGTGAAGCTGAACGTGGTGC
TTGGCGGGGCGACATGGCTGGAGCCCAATCCCATTGACCGCTGCTTCACCGACGGCAACC
TTGTGACCGGCGCGGCATGGCCTGGCCACCCGGAGTTCATCTCCCAGCTCATGGCATTGC
TTGGCATCAAGGTCTCCTTCTGAAGCAACGAGAGGTCAGGTCCCAGCGTTTTTGCACGCG
ATATAGCAAGACACAGCTTTGGGCTTTCGTCTAAGATATATACAGTCTTACCGATACTGT
ACCAGTCTGCTGTCGTTTTTTGTGCTTGAAATAATAAGATAATTACT

CDS

1164 bp

>Os04t0671700-01 ThiJ/PfpI domain containing protein.
ATGGCTCCCAAGAAGGTGCTCCTGCTCTGCGGAGACTACATGGAGGACTACGAGGCCATG
GTTCCGTTCCAAGCGCTGCAAGCGTACGGGGTGTCCGTGGATGCTGCCTGCCCCGGCAAG
AAGGCCGGCGACTCGTGCCGCACCGCCGTCCATCAGGGGATTGGCCACCAGACATATGCT
GAGTCAAGGGGCCACAATTTCGCACTTAATGCTTCGTTTGATGAGGTTAATATCAATGAA
TATGATGGCTTGGTAATTCCTGGAGGCCGTGCACCAGAGTATCTCGCCATGGATGAAAAG
GTTCTTGATTTAGTAAGGAAATTCTCTGATGCGAAGAAACCTATTGCATCAGTTTGCCAT
GGACAGTTGATTTTGGCAGCAGCTGGAGTAGTCCAGAACCGTAAATGCACCGCATATCCT
GCTGTTAAACCAGTTTTGGTTGCTGCTGGTGCTAAGTGGGAAGAAGCTGATACTATGGAC
AAATGCACAGTTGATGGAAATCTTGTCACTGCAGTGGCTTACGATGCACATCCTGAATTC
ATCAGCCTTTTTGTGAAAGCGCTTGGAGGCTCTGTAACTGGCTCAAACAAACGGATATTG
TTCCTTTGTGGGGATTACATGGAAGATTATGAGGTTATGGTACCATTTCAGTCTCTTCAA
GCCCTTGGTTGCCATGTTGATGCAGTTTGCCCTGACAAGGGTGCTGGGGAGAAATGCCCA
ACTGCCATACATGACTTTGAAGGTGACCAAACATACAGCGAGAAGCCTGGTCACGATTTT
GCTTTGACAGCATCATTTGACAATGTGGATGCATCAAGCTATGATGCACTTGTAATTCCT
GGTGGACGGGCTCCTGAGTACCTTGCACTGAACGATAAAGTCATTAGCCTTGTGAAGGGC
TTCATGGATAAAGCAAAGCCAGTCGCCTCAATTTGCCATGGCCAACAGATTTTATCTGCT
GCTGGAGTCCTTCAGGGAAGGAAATGCACGGCGTATCCTGCGGTGAAGCTGAACGTGGTG
CTTGGCGGGGCGACATGGCTGGAGCCCAATCCCATTGACCGCTGCTTCACCGACGGCAAC
CTTGTGACCGGCGCGGCATGGCCTGGCCACCCGGAGTTCATCTCCCAGCTCATGGCATTG
CTTGGCATCAAGGTCTCCTTCTGA

Protein

388 aa

>Os04t0671700-01 ThiJ/PfpI domain containing protein.
MAPKKVLLLCGDYMEDYEAMVPFQALQAYGVSVDAACPGKKAGDSCRTAVHQGIGHQTYA
ESRGHNFALNASFDEVNINEYDGLVIPGGRAPEYLAMDEKVLDLVRKFSDAKKPIASVCH
GQLILAAAGVVQNRKCTAYPAVKPVLVAAGAKWEEADTMDKCTVDGNLVTAVAYDAHPEF
ISLFVKALGGSVTGSNKRILFLCGDYMEDYEVMVPFQSLQALGCHVDAVCPDKGAGEKCP
TAIHDFEGDQTYSEKPGHDFALTASFDNVDASSYDALVIPGGRAPEYLALNDKVISLVKG
FMDKAKPVASICHGQQILSAAGVLQGRKCTAYPAVKLNVVLGGATWLEPNPIDRCFTDGN
LVTGAAWPGHPEFISQLMALLGIKVSF*

5'UTR

chr04:34270788..34270846 (- strand) : 59 bp

CDS

chr04:34270734..34270787 (- strand) : 54 bp

chr04:34270525..34270641 (- strand) : 117 bp

chr04:34269225..34269665 (- strand) : 441 bp

chr04:34268743..34269105 (- strand) : 363 bp

chr04:34268099..34268287 (- strand) : 189 bp

3'UTR

chr04:34267955..34268098 (- strand) : 144 bp

FASTA

>Os04t0671700-01 class=Sequence position=chr04:34267955..34270846 (- strand)
AGTCTCTCGG CTTCTAGACT AGGGAAGCTC ACCAACCCAA GAACAAGAAG TGATCGGAGA TGGCTCCCAA GAAGGTGCTC
CTGCTCTGCG GAGACTACAT GGAGGACTAC GAGGTGAGGC AAATCTTCCT CTTGTTCCGT GTCTTGTGTG TTCGATTCGT
GTCCTCGCGA TTCCAATGGG GTTTTCTTGG AATCTTGTGG ATCAGGCCAT GGTTCCGTTC CAAGCGCTGC AAGCGTACGG
GGTGTCCGTG GATGCTGCCT GCCCCGGCAA GAAGGCCGGC GACTCGTGCC GCACCGCCGT CCATCAGGGG ATTGGCCACC
AGGTACTTGG AATGATTCGA TTCCGCTCGA TTTGGATAGG GTTTAGTATA ACTAGTTAGG GCTTGGTCTG ATGAATTGAA
CATGGCGGAT TCCCATTCTA GAGTGGTCAG GAATATCTTC GCTTTCTTGC CTTTGAGTAA TTTTAGGATG TAATTTCTAG
GATTAATACA CATCTGCTCA TCGCAATTGG CAGAAGGGGG AAAGAAAAGG AGAGTACACA CAGTCACACA ACGGGACAGG
GAAAACATAT GTGCAACTAG GTTTATTTTT GAGAGCTCAT AATGAAATGA CAGATTTCTT GGTATGATTG ATCCATTAGC
TTTATCTGTT ATTCTTTCTA TTCTCCAAAT ATCTGGTTTA GCATTGCGAG ATAAGTTTGA CGGAATAATC AGTCATGAGC
AGAAATATTC CTTAACTGTC TACAAAATGG GATAGCTCTT CTGCATGATT GAATGGAAAA ATCATTTGAA CATTTTGGAT
ACTGAATATA CTTAGACAGC CATTCTTATT TCTTTCGTCA CTTAAGTGAA CTGTTGATTG GTTCATGATT TGGGGGTTAA
CTGTTGCTGT AGAGATTTCT TATAAATTCA TATCCTTGTC TGTTTCCCAT ATTATTGCAT TAGTTCCTGC TTCTCTTTAG
ATGGTGTTGC TTCTTTCAAA ACTAATTTGG GGGTCCTCTT TGTCTACTGG ACTACTACTC CCTTTAGTAA TGGAATCTTT
GTTTTCTCTG AAGCACTCGA TTATAAGGAT CGTCTGTATT GTTGGTTCTT TTAGGTGTGA TAGTATGGTG GTACTTTTCG
TCTTTCTAAC ATAAGTTTGC TTTGACAAAT TAAATTAGAT TCATTTTGAT TCATCATGCA GACATATGCT GAGTCAAGGG
GCCACAATTT CGCACTTAAT GCTTCGTTTG ATGAGGTTAA TATCAATGAA TATGATGGCT TGGTAATTCC TGGAGGCCGT
GCACCAGAGT ATCTCGCCAT GGATGAAAAG GTTCTTGATT TAGTAAGGAA ATTCTCTGAT GCGAAGAAAC CTATTGCATC
AGTTTGCCAT GGACAGTTGA TTTTGGCAGC AGCTGGAGTA GTCCAGAACC GTAAATGCAC CGCATATCCT GCTGTTAAAC
CAGTTTTGGT TGCTGCTGGT GCTAAGTGGG AAGAAGCTGA TACTATGGAC AAATGCACAG TTGATGGAAA TCTTGTCACT
GCAGTGGCTT ACGATGCACA TCCTGAATTC ATCAGCCTTT TTGTGAAAGC GCTTGGAGGC TCTGTAACTG GCTCAAACAA
ACGGATATTG TTCCTTTGTG GGGTATGTTT AGGGAAATTT CATTCAATTG AATTCGTATG ACTACTTTCT TATTTTCTTC
ATTTTTCATA AGTCATACCA TCTCTGCTGA ACCTCTTTGC TTAACTACAT GCTTATAACA GGATTACATG GAAGATTATG
AGGTTATGGT ACCATTTCAG TCTCTTCAAG CCCTTGGTTG CCATGTTGAT GCAGTTTGCC CTGACAAGGG TGCTGGGGAG
AAATGCCCAA CTGCCATACA TGACTTTGAA GGTGACCAAA CATACAGCGA GAAGCCTGGT CACGATTTTG CTTTGACAGC
ATCATTTGAC AATGTGGATG CATCAAGCTA TGATGCACTT GTAATTCCTG GTGGACGGGC TCCTGAGTAC CTTGCACTGA
ACGATAAAGT CATTAGCCTT GTGAAGGGCT TCATGGATAA AGCAAAGCCA GTCGCCTCAA TTTGCCATGG CCAACAGATT
TTATCTGCTG CTGGAGTCCT TCAGGTACAT GATAATGATT AATTTTCTAC CATTGCTCTA CATTAATCGT ACTTACTTGA
TTACTTCTAT ACCTagtgtt ggaatataaa gtgaattgtc cgtctttcct catcagctta agcttttgga ttgaactggt
cggtgcatgc aactcaatac CTAGCGATAG GAAAATTTAC CTTGAACAAA ACAAAAATAA TGCAACAATA TCTATTCTTG
ATTAATGGAT AATTAAATGA TTAAATCATT CCTGCAAAGT AAAAGCATTT TCATAGTGTG GTAAGGTAGG CAACAAGACG
TACTATTACA GTATCAGTAT GTCACTATCC TTCTTAGCGT AGTTATTCAG GATCACTGAA TTGCTTCCGA AAATCTCACA
CAAATGGACA CAAACCTGTT TGATGCACGC AGCGATGCTC CCCAGTCTCC CTAATTGTGG ATGATAATAT GATATGCAGG
GAAGGAAATG CACGGCGTAT CCTGCGGTGA AGCTGAACGT GGTGCTTGGC GGGGCGACAT GGCTGGAGCC CAATCCCATT
GACCGCTGCT TCACCGACGG CAACCTTGTG ACCGGCGCGG CATGGCCTGG CCACCCGGAG TTCATCTCCC AGCTCATGGC
ATTGCTTGGC ATCAAGGTCT CCTTCTGAAG CAACGAGAGG TCAGGTCCCA GCGTTTTTGC ACGCGATATA GCAAGACACA
GCTTTGGGCT TTCGTCTAAG ATATATACAG TCTTACCGAT ACTGTACCAG TCTGCTGTCG TTTTTTGTGC TTGAAATAAT
AAGATAATTA CT

Locus: Os04g0671700

Loading...

Locus: Os04g0671700

Loading...