Os04t0674600-01

Locus

Os04g0674600

Description

Similar to H0103C06.1 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YSL10

CGSNL Gene Name

YELLOW STRIP-LIKE GENE 10

Oryzabase Gene Symbol Synonym(s)

OsYSL10

Oryzabase Gene Name Synonym(s)

rice YSL (yellow stripe-like) gene 10, Probable metal-nicotianamine transporter YSL10, Protein YELLOW STRIPE LIKE 10, yellow stripe 1-like transporter 10

Transcript Evidence

AK069645 (DDBJ, Best hit)

Protein Evidence

Q259I1 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

J023027O16 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0674600-01)

Others

Oryzabase (8351)

Transcript

2369 bp

>Os04t0674600-01 Similar to H0103C06.1 protein.
GCCTCCACACCTCGCAACCGCGATCGATCGAGAGAGAGAGCGAGAGCGAGAGCTCAATTC
GCGGGCCATGGCGAGGAGCGGGAGGGAGCGTAGAGATCAGGAGGAGGAGGCGGCGGTGGT
GTCGGTGGAGCGGGTGTTCGAGGGGAGGGTGGTGCCGGGGTGGAAGGAGCAGGTGACGCT
GCGGGCGCTGGCGGTGAGCGCGCTGCTGGGCGCCATGTTCAGCGTGATCGTGATGAAGCT
GAACCTGACGACGGGGATCATCCCCTCGCTCAACGTCTCCGCGGGGCTCCTCGGCTTCTT
CCTCCTCACGTCGTGGACCAAGCTCCTCGACAAGGCCGGCGTCGCCAGCGTCCGCCCCTT
CACCCGCCAGGAGAACACCGTCGTCCAGACCTGCGTCGTCGCCTGCTCCGGCATCGCCTT
CAGCGGGGGTTTTGGCAGCTACATATTCGCGATGAGCGACAGGATCAGCGACCAGTCAGG
CGAGGCCAGGGACGAGCACAACATCAAGAACCCCAGCTTGGGCTGGATGATTGGATTCCT
CTTCATTGTCAGCTTCCTGGGCCTCTTCTCAGTTGTGCCACTCAGGAAGATAATGATCAT
CGATTACAAGCTCATATACCCGAGTGGCACTGCAACCGCACATCTCATCAACAGCTTCCA
CACTCCCCAGGGTGCAAAGCTTGCCAAGATGCAGGTCAAAATGCTGGGCAAATTCTTCGT
GATGAGCTTCTCCTGGGGCTTCTTCCAGTGGTTCTACACCGGCGGCGACGGTTGCGGGTT
CATGTCGTTCCCGACGCTGGGTCTCGAGGCCTACAGAAACAAGTTCTTCTTCGATTTCTC
TGCGACGTACGTCGGCGTCGGGATGATCTGCCCTTACCTCGTCAACATCTCCGTGCTCCT
CGGAGGCGTCATGTCGTGGGGAATCATGTGGCCTCTCATCGAGCACAAGAAGGGTGACTG
GTATCCTGCTGACCTCAAACCCAGCAGCCTCCGCGGCATCGTCGGCTACCGGGTGTTCAT
CTCCATTTCACTCATCCTCGGCGACGGGCTGTACAACTTTCTGAAGGTGATGACAAGAAC
CACAACGGCGCTGGTGATGCAGGTGCGCGCGATGATGTCTGAGCCGACGCTGCCGGTCTC
CGGCGGCGGCGGGCAGACGccggaggagacgttcgacgacaagcggcggacggagctgtt
cctcaaggaccagatcccgaactggctggcgctgagcgcgtacgtggtgatcgcggtggt
gtcgatcgcgacggtgccccgcatcttccaccagctgaggtggtaccacgtcgcggtgtc
gtacgtggtggcgccggtgctggcgttctgcaacgcgtacgggtgcgggctgacggactg
gtcgctggcgacgacgtacggcaagctggccatcttcacggtgggggcgtgggcggacgc
gtcggacggcggcatcatcgcggggctggcggcgtgcggcgtgatgatcgggatcgtgtc
gacggcgtcggacctgacgcaggacttcaagaccgggtacatgacgctggcgtcgccgcg
gtccatgttcgtgagccaggtgatcggcaccgccatggggtgcgtgatcgcgccgtcggt
gttctggctcttctacaaggcgttccacgacatcgggatgcCGGGGTCGGAGTACCCGTC
GCCGAACGCGCTGGTGTACCGGAACATGGCCATCCTCGGGGTGCAGGGCCTCGGCTCGCT
GCCCAAGCACTGCCTCGACCTCTGCATCGGCTTCTTCGTCGCCGCCATCGCCGTCAACCT
CGCCAGGGACCTCGCGGCGCCCAAGGTGGCGAGGTTCCTCCCGCTGCCGATGGCCATGGC
GATCCCCTTCTACCTCGGCCCCTACTTCGGCATCGACATGTGCATCGGCAGCCTCATCCG
CTTCGTCTGGGACCGCCTCGACGGCGCCAGGGCCAAGGCGTTCGCTCCCCCCGTCGCGTC
GGGCCTCATCTGCGGCGACGGCATCTGGACGCTGCCGCAGTCGGTGCTCGCCCTCGCCGG
TGTCAAGCCTCCCATCTGCATGAAATTCCTCTCCCGGACCACCAACATCAAGGTCGACGC
GTTCATCGCCAAGCTCCCCTCCTCCTAGCTACCATGCAGCTGATCGACGAGCTAGCCATC
TATCTAGCTAGCTCATGACCACTCACTCAACCATGACAACTTCATATATAGCTAGCAGTA
GCACATACATTAATGTCGTAGCCTCCTTGTGTCTTGCTTCCTTTTAGAATCAGATGCCTT
TGCTAGTAGCCCGCATGCATGCATGTGACACATATAAATAGCTACTAGGAACCGAGCAGC
AATGCAAGTACTACATTATTTGGACTGTC

CDS

2061 bp

>Os04t0674600-01 Similar to H0103C06.1 protein.
ATGGCGAGGAGCGGGAGGGAGCGTAGAGATCAGGAGGAGGAGGCGGCGGTGGTGTCGGTG
GAGCGGGTGTTCGAGGGGAGGGTGGTGCCGGGGTGGAAGGAGCAGGTGACGCTGCGGGCG
CTGGCGGTGAGCGCGCTGCTGGGCGCCATGTTCAGCGTGATCGTGATGAAGCTGAACCTG
ACGACGGGGATCATCCCCTCGCTCAACGTCTCCGCGGGGCTCCTCGGCTTCTTCCTCCTC
ACGTCGTGGACCAAGCTCCTCGACAAGGCCGGCGTCGCCAGCGTCCGCCCCTTCACCCGC
CAGGAGAACACCGTCGTCCAGACCTGCGTCGTCGCCTGCTCCGGCATCGCCTTCAGCGGG
GGTTTTGGCAGCTACATATTCGCGATGAGCGACAGGATCAGCGACCAGTCAGGCGAGGCC
AGGGACGAGCACAACATCAAGAACCCCAGCTTGGGCTGGATGATTGGATTCCTCTTCATT
GTCAGCTTCCTGGGCCTCTTCTCAGTTGTGCCACTCAGGAAGATAATGATCATCGATTAC
AAGCTCATATACCCGAGTGGCACTGCAACCGCACATCTCATCAACAGCTTCCACACTCCC
CAGGGTGCAAAGCTTGCCAAGATGCAGGTCAAAATGCTGGGCAAATTCTTCGTGATGAGC
TTCTCCTGGGGCTTCTTCCAGTGGTTCTACACCGGCGGCGACGGTTGCGGGTTCATGTCG
TTCCCGACGCTGGGTCTCGAGGCCTACAGAAACAAGTTCTTCTTCGATTTCTCTGCGACG
TACGTCGGCGTCGGGATGATCTGCCCTTACCTCGTCAACATCTCCGTGCTCCTCGGAGGC
GTCATGTCGTGGGGAATCATGTGGCCTCTCATCGAGCACAAGAAGGGTGACTGGTATCCT
GCTGACCTCAAACCCAGCAGCCTCCGCGGCATCGTCGGCTACCGGGTGTTCATCTCCATT
TCACTCATCCTCGGCGACGGGCTGTACAACTTTCTGAAGGTGATGACAAGAACCACAACG
GCGCTGGTGATGCAGGTGCGCGCGATGATGTCTGAGCCGACGCTGCCGGTCTCCGGCGGC
GGCGGGCAGACGccggaggagacgttcgacgacaagcggcggacggagctgttcctcaag
gaccagatcccgaactggctggcgctgagcgcgtacgtggtgatcgcggtggtgtcgatc
gcgacggtgccccgcatcttccaccagctgaggtggtaccacgtcgcggtgtcgtacgtg
gtggcgccggtgctggcgttctgcaacgcgtacgggtgcgggctgacggactggtcgctg
gcgacgacgtacggcaagctggccatcttcacggtgggggcgtgggcggacgcgtcggac
ggcggcatcatcgcggggctggcggcgtgcggcgtgatgatcgggatcgtgtcgacggcg
tcggacctgacgcaggacttcaagaccgggtacatgacgctggcgtcgccgcggtccatg
ttcgtgagccaggtgatcggcaccgccatggggtgcgtgatcgcgccgtcggtgttctgg
ctcttctacaaggcgttccacgacatcgggatgcCGGGGTCGGAGTACCCGTCGCCGAAC
GCGCTGGTGTACCGGAACATGGCCATCCTCGGGGTGCAGGGCCTCGGCTCGCTGCCCAAG
CACTGCCTCGACCTCTGCATCGGCTTCTTCGTCGCCGCCATCGCCGTCAACCTCGCCAGG
GACCTCGCGGCGCCCAAGGTGGCGAGGTTCCTCCCGCTGCCGATGGCCATGGCGATCCCC
TTCTACCTCGGCCCCTACTTCGGCATCGACATGTGCATCGGCAGCCTCATCCGCTTCGTC
TGGGACCGCCTCGACGGCGCCAGGGCCAAGGCGTTCGCTCCCCCCGTCGCGTCGGGCCTC
ATCTGCGGCGACGGCATCTGGACGCTGCCGCAGTCGGTGCTCGCCCTCGCCGGTGTCAAG
CCTCCCATCTGCATGAAATTCCTCTCCCGGACCACCAACATCAAGGTCGACGCGTTCATC
GCCAAGCTCCCCTCCTCCTAG

Protein

687 aa

>Os04t0674600-01 Similar to H0103C06.1 protein.
MARSGRERRDQEEEAAVVSVERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNL
TTGIIPSLNVSAGLLGFFLLTSWTKLLDKAGVASVRPFTRQENTVVQTCVVACSGIAFSG
GFGSYIFAMSDRISDQSGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDY
KLIYPSGTATAHLINSFHTPQGAKLAKMQVKMLGKFFVMSFSWGFFQWFYTGGDGCGFMS
FPTLGLEAYRNKFFFDFSATYVGVGMICPYLVNISVLLGGVMSWGIMWPLIEHKKGDWYP
ADLKPSSLRGIVGYRVFISISLILGDGLYNFLKVMTRTTTALVMQVRAMMSEPTLPVSGG
GGQTPEETFDDKRRTELFLKDQIPNWLALSAYVVIAVVSIATVPRIFHQLRWYHVAVSYV
VAPVLAFCNAYGCGLTDWSLATTYGKLAIFTVGAWADASDGGIIAGLAACGVMIGIVSTA
SDLTQDFKTGYMTLASPRSMFVSQVIGTAMGCVIAPSVFWLFYKAFHDIGMPGSEYPSPN
ALVYRNMAILGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDLAAPKVARFLPLPMAMAIP
FYLGPYFGIDMCIGSLIRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQSVLALAGVK
PPICMKFLSRTTNIKVDAFIAKLPSS*

5'UTR

chr04:34444007..34444073 (- strand) : 67 bp

CDS

chr04:34443649..34444006 (- strand) : 358 bp

chr04:34442654..34442817 (- strand) : 164 bp

chr04:34442436..34442533 (- strand) : 98 bp

chr04:34442195..34442329 (- strand) : 135 bp

chr04:34441759..34441948 (- strand) : 190 bp

chr04:34440572..34441687 (- strand) : 1116 bp

3'UTR

chr04:34440331..34440571 (- strand) : 241 bp

FASTA

>Os04t0674600-01 class=Sequence position=chr04:34440331..34444073 (- strand)
GCCTCCACAC CTCGCAACCG CGATCGATCG AGAGAGAGAG CGAGAGCGAG AGCTCAATTC GCGGGCCATG GCGAGGAGCG
GGAGGGAGCG TAGAGATCAG GAGGAGGAGG CGGCGGTGGT GTCGGTGGAG CGGGTGTTCG AGGGGAGGGT GGTGCCGGGG
TGGAAGGAGC AGGTGACGCT GCGGGCGCTG GCGGTGAGCG CGCTGCTGGG CGCCATGTTC AGCGTGATCG TGATGAAGCT
GAACCTGACG ACGGGGATCA TCCCCTCGCT CAACGTCTCC GCGGGGCTCC TCGGCTTCTT CCTCCTCACG TCGTGGACCA
AGCTCCTCGA CAAGGCCGGC GTCGCCAGCG TCCGCCCCTT CACCCGCCAG GAGAACACCG TCGTCCAGAC CTGCGTCGTC
GCCTGCTCCG GCATCGCCTT CAGCGGTACG GTTTCCCCGC TGCCATTCTT CGCACTCGCC GCGGATCGGA TCGCTCGCTC
GCTGCACGAT TCAGTGATTG CGCGATGCAA ATTTTGCGTC GAATCGAATG GCGACGGATC ACTTGTTTGG GCCGTAAATT
AGGCCTCGAT GGCCTCCTTT TTGGATGTAT ATCAAGGCCC ACAGGCCACA ATTCCATTTC GGTGTGTAGC ATGAATTTTG
ATCTTAGGTT TTTTCTGGAT TCTTTTTCTT GTTCTGTGCT TGCCTTTCTT AAAGTTCAGG TGTTTGAATT TCCAACCAAA
ATGATGTTTT TAGCACACCA TTGGAAACTG GCCTATTGAG CATACTTCCT CCGTCTAAAA AAAGACTAat gtccagattc
attatattac gaaatgtctt atctaatatt aggttgtttt ttggtgggac gaagggagta CACAACATAG GTGTACTTCT
AATTGCCACG TAGGACAAAT ACGGTGCTTA GCAAAAAAAA ATGATTGCTG CATTTAAATA CAGAGGATAA TGTAGCCAAC
TAGCCATGGC CCATGGGAAA GCACCTACAA AGAAATGATT TGATTGGAGA CTCATTCCTC GTGTTGTTTC CCCTAGCACT
TGGTAATTTG CATCCTTACT AACAAAAAAA AACTTATCTT TCTTTAAGCA CCTTGTTACT ATAAGCATAC ATGTTCCGTT
CTTCACGTCC TAGACTTTTA TCACTGCTCT CCCTGTTATC AGTAGTACAT CCACAGAGAG CACTGTGCAC TACGTTCTCT
GCTTGGTGTC AGGGTGGTGA TGGTTTCAGA TGCTGATCTA TGCACTGGTG GTACAGGGGG TTTTGGCAGC TACATATTCG
CGATGAGCGA CAGGATCAGC GACCAGTCAG GCGAGGCCAG GGACGAGCAC AACATCAAGA ACCCCAGCTT GGGCTGGATG
ATTGGATTCC TCTTCATTGT CAGCTTCCTG GGCCTCTTCT CAGTTGTGCC ACTCAGGAAG GTACTTAGTA CATTTCATCA
GCTCAGCTGT TACAGTTTCT CCTAAAATTC AGAGATATAT GATTTCTTTG AAGGACATAG TTAAATTAAT TGAACCATGA
TGTTAATTTT TCTCTGTCAG ATAATGATCA TCGATTACAA GCTCATATAC CCGAGTGGCA CTGCAACCGC ACATCTCATC
AACAGCTTCC ACACTCCCCA GGGTGCAAAG CTTGCCAAGT ACGGTTTTTT TTTCAGATAA GAAAGTTTGC TAAAGATATG
TACATGTGGT GAATACAGAG AACAAATAAG ACTCTTGTCT GAATTCTGAA TCATTTTCCT GCAGGATGCA GGTCAAAATG
CTGGGCAAAT TCTTCGTGAT GAGCTTCTCC TGGGGCTTCT TCCAGTGGTT CTACACCGGC GGCGACGGTT GCGGGTTCAT
GTCGTTCCCG ACGCTGGGTC TCGAGGCCTA CAGAAACAAG TATTGTCTTT gtttttttat acacgacgtc gttaatattt
cgtataatac attatttaaa aatataagtt aaagttacat ttctttgatg ataaaacaag taataataaa ataaacaata
ataatacaag tattttgaat aaaagaaata gacaaatgtc atgCTAGCTT GAAACATACA GATGCTCGCC ACACTGGACA
GTCAACAACA GTTAACTGAA TTCTTCAGTT GGTTTCTTGC TGCAGGTTCT TCTTCGATTT CTCTGCGACG TACGTCGGCG
TCGGGATGAT CTGCCCTTAC CTCGTCAACA TCTCCGTGCT CCTCGGAGGC GTCATGTCGT GGGGAATCAT GTGGCCTCTC
ATCGAGCACA AGAAGGGTGA CTGGTATCCT GCTGACCTCA AACCCAGCAG CCTCCGCGGC ATCGTCGGCT ACCGGGTAGA
ACGAGCTTCT TGCAAATGAT CATCTGTTGC ATGATCAATG GAGTAATTGT GATTCGATCG ATGCAGGTGT TCATCTCCAT
TTCACTCATC CTCGGCGACG GGCTGTACAA CTTTCTGAAG GTGATGACAA GAACCACAAC GGCGCTGGTG ATGCAGGTGC
GCGCGATGAT GTCTGAGCCG ACGCTGCCGG TCTCCGGCGG CGGCGGGCAG ACGccggagg agacgttcga cgacaagcgg
cggacggagc tgttcctcaa ggaccagatc ccgaactggc tggcgctgag cgcgtacgtg gtgatcgcgg tggtgtcgat
cgcgacggtg ccccgcatct tccaccagct gaggtggtac cacgtcgcgg tgtcgtacgt ggtggcgccg gtgctggcgt
tctgcaacgc gtacgggtgc gggctgacgg actggtcgct ggcgacgacg tacggcaagc tggccatctt cacggtgggg
gcgtgggcgg acgcgtcgga cggcggcatc atcgcggggc tggcggcgtg cggcgtgatg atcgggatcg tgtcgacggc
gtcggacctg acgcaggact tcaagaccgg gtacatgacg ctggcgtcgc cgcggtccat gttcgtgagc caggtgatcg
gcaccgccat ggggtgcgtg atcgcgccgt cggtgttctg gctcttctac aaggcgttcc acgacatcgg gatgcCGGGG
TCGGAGTACC CGTCGCCGAA CGCGCTGGTG TACCGGAACA TGGCCATCCT CGGGGTGCAG GGCCTCGGCT CGCTGCCCAA
GCACTGCCTC GACCTCTGCA TCGGCTTCTT CGTCGCCGCC ATCGCCGTCA ACCTCGCCAG GGACCTCGCG GCGCCCAAGG
TGGCGAGGTT CCTCCCGCTG CCGATGGCCA TGGCGATCCC CTTCTACCTC GGCCCCTACT TCGGCATCGA CATGTGCATC
GGCAGCCTCA TCCGCTTCGT CTGGGACCGC CTCGACGGCG CCAGGGCCAA GGCGTTCGCT CCCCCCGTCG CGTCGGGCCT
CATCTGCGGC GACGGCATCT GGACGCTGCC GCAGTCGGTG CTCGCCCTCG CCGGTGTCAA GCCTCCCATC TGCATGAAAT
TCCTCTCCCG GACCACCAAC ATCAAGGTCG ACGCGTTCAT CGCCAAGCTC CCCTCCTCCT AGCTACCATG CAGCTGATCG
ACGAGCTAGC CATCTATCTA GCTAGCTCAT GACCACTCAC TCAACCATGA CAACTTCATA TATAGCTAGC AGTAGCACAT
ACATTAATGT CGTAGCCTCC TTGTGTCTTG CTTCCTTTTA GAATCAGATG CCTTTGCTAG TAGCCCGCAT GCATGCATGT
GACACATATA AATAGCTACT AGGAACCGAG CAGCAATGCA AGTACTACAT TATTTGGACT GTC