Os04t0674800-01

Locus

Os04g0674800

Description

Similar to CEL1=CELLULASE 1 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GH9C1

CGSNL Gene Name

GLYCOSIDE HYDROLASE 9C1

Oryzabase Gene Symbol Synonym(s)

OsGH9C1

Oryzabase Gene Name Synonym(s)

glycoside hydrolase OsGH9C1, glycoside hydrolase 9C1

Transcript Evidence

AK119913 (DDBJ, Best hit)

Protein Evidence

Q0J930 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Cellular Component: extracellular region (GO:0005576)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Molecular Function: carbohydrate binding (GO:0030246)

Functional domain (InterPro)

Glycoside hydrolase, family 9 (IPR001701)

Six-hairpin glycosidase-like (IPR008928)

Six-hairpin glycosidase (IPR012341)

Glycoside hydrolase, family 9, active site (IPR018221)

Carbohydrate binding domain CBM49 (IPR019028)

Full-length cDNA

002-183-F01 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0674800-01)

RiceXPro (AK119913)

Others

Oryzabase (11719)

KEGG (Os04t0674800-01)

Transcript

2216 bp

>Os04t0674800-01 Similar to CEL1=CELLULASE 1 (Fragment).
AATCCAGTATTCCACTACCGAGGTCGAGCAATGGCGGCGACGATGAACAAGACGCCGGCA
ACCACCTTCCTGCTGATACCGGCGGCGGCGTCGCTGGTTCTCCTCCTCGCGGCGGCCGCG
TCGGTGGAGGCGTCGGCGTTCGACTACGCCGGCGCGTTCGACAAGTGCCTCCTGTTCTTC
GAGGCGCAGCGCTCCGGCAAGCTCCCCGACGACCGCCTCGTCCGGTGGCGCGGCGACTCC
GCCCTCACCGACGGCTTCTCCCAGGGGGTGGATTTGGTGGGCGGGTACTACGACTCCGGC
GACCACGTGAAGTTCGGGCTCCCGATGGCGTACGCGGTGACGATGCTGTCGTGGGGGGTG
GTCGAGTTCGAGAAGGAGATGGTCGACGGCAACAAGCTCCACCGCGTCCTCGACGCCATC
CGCTGGGGCACCAACTACTTCGTCAAGGCCCACACCCAGCACAACGCCCTCTGGGTCCAG
GTGGGTGACGGCGACAGCGACCACCTGTGCTGGGAGCGCGCCGAGGACATGTCGACGCCG
CGCACGGCGTTCAAGATCGACATCAACAACCCCGGGTCGGAGGTCGCCGGCGAGACCGCC
GCCGCTCTCGCCGCCGCCGCCAAGGCCTTCAAGCCCTACGACCGCATGTACTCCGACCTC
CTCCTCCTCCACTCCAAGCAGCTGTTCACGTTCGCGGACACGTTCAGGGGCAAGTACGAC
GACTCGCTGCAGAGCGCCAAGAAGTTCTACCCGTCGGCGTCCGGCTACCAGGACGAGCTG
CTGTGGGCGGCGGCGTGGCTGTACGAGGCGACCGGCGACGAGCAGTACCTCCGCTACGTG
TCCCAGAACGCGGAGGCGTTCGGCGGCACCGGCTGGGCCGTCACCGAGTTCTCCTGGGAC
AACAAGTACGCCGGCCTCCAGGTCCTCCTCTCCAAGGTCCTCTTCGAGCAGGGCGGCAGC
GCCGCCGGCTACGCCGACACGCTGAAGCAGTATCAGGCCAAGGCCGAGTTCTTCCTCTGC
GCCTGCCTCCAGAAGAACAACGGCCACAACGTCAAGATGACCCCTGGTGGTCTCATGTAC
GTGAGCGACTGGAGCAACATGCAGTACGTGAGCTCGTCGGCGTTCCTCCTCACCGTCTAC
GCCGACTACCTCGCCGAGTCGCGGGGAACGCTCAGGTGCCCGGACGGCGAGGTGAAGCCG
GCGGAGATCCTCCGGTTCGCGAGGTCGCAGGTCGACTACGTCCTCGGCAAGAACCCCAAG
GGGATGAGCTACATGGTCGGATACGGCAGCTACTACCCGACGCACGTCCACCACCGCGGC
GCGTCCATCCCGTCCATCTACGCCATGAACGCCACCGTCGGGTGCATGGAAAGCTTCGAC
AAGTACTACAACAGCAAGAACGCCGACCCCAACGTCCTCCACGGCGCCCTCGTCGGCGGC
Cccgacgccaacgacgcctacgacgacgaccgctgcaactaccagcacgccgagcccacc
ctcgccggcaacgcccccatgtccggcgtcttcgcccgcctcgccgcctcgcccgccgat
aacacgccggagtacacgccggcgCCAAATGCCCCCTCGCCATCAAATGGTGGGTCGCCG
TTGGAGTTCGTGCACACGGTGACGAACACGTGGAAGGCAAACGGCGTGGACTACTACCGG
CACGTGGTGACGGCGAAGAACACGTGCGGCCACGCCATCACCTACCTGAAGCTGCAGATC
AAGGAGCTCTCCGGGGAGATCTACGGCGTCTCCCGCACGAACGCCAAGGACATGTACGAG
TTCCCGTCGTGGATGACACGGCTCGACGCCGGCGCGCAGCTCACCATCGTCTACATCCAG
GGCGGCCCCGCCGCCAAGATCGCCGTCGTCGAGTACAAGACGGCCTGAGAATGGCACGAC
GACGACGACTGATTTCTGCCTTTCCTTTTTTCCATTTTAGTTTTGGTGTGTGGTTGGCTG
CTGCTTTTCAGCAAACAGGTGGTGTGCAATCTCGAAGCAACGAGTCTGTGATGTCACCTC
TGACCACGACTGCTTTGAGATGTGGACATGCACTGTTTCTTCTGTACTTGGAATGGCATA
GGAGATCTCTCAGCTTTTCTTTTAGCTTTCGTGATTTCTCCATTCTTTCCGCTGTGCACG
CCTGTGTGTTTTATATGTTCAAATTAAGCAGAAAACTGTGACATGATGTTTTTGCT

CDS

1878 bp

>Os04t0674800-01 Similar to CEL1=CELLULASE 1 (Fragment).
ATGGCGGCGACGATGAACAAGACGCCGGCAACCACCTTCCTGCTGATACCGGCGGCGGCG
TCGCTGGTTCTCCTCCTCGCGGCGGCCGCGTCGGTGGAGGCGTCGGCGTTCGACTACGCC
GGCGCGTTCGACAAGTGCCTCCTGTTCTTCGAGGCGCAGCGCTCCGGCAAGCTCCCCGAC
GACCGCCTCGTCCGGTGGCGCGGCGACTCCGCCCTCACCGACGGCTTCTCCCAGGGGGTG
GATTTGGTGGGCGGGTACTACGACTCCGGCGACCACGTGAAGTTCGGGCTCCCGATGGCG
TACGCGGTGACGATGCTGTCGTGGGGGGTGGTCGAGTTCGAGAAGGAGATGGTCGACGGC
AACAAGCTCCACCGCGTCCTCGACGCCATCCGCTGGGGCACCAACTACTTCGTCAAGGCC
CACACCCAGCACAACGCCCTCTGGGTCCAGGTGGGTGACGGCGACAGCGACCACCTGTGC
TGGGAGCGCGCCGAGGACATGTCGACGCCGCGCACGGCGTTCAAGATCGACATCAACAAC
CCCGGGTCGGAGGTCGCCGGCGAGACCGCCGCCGCTCTCGCCGCCGCCGCCAAGGCCTTC
AAGCCCTACGACCGCATGTACTCCGACCTCCTCCTCCTCCACTCCAAGCAGCTGTTCACG
TTCGCGGACACGTTCAGGGGCAAGTACGACGACTCGCTGCAGAGCGCCAAGAAGTTCTAC
CCGTCGGCGTCCGGCTACCAGGACGAGCTGCTGTGGGCGGCGGCGTGGCTGTACGAGGCG
ACCGGCGACGAGCAGTACCTCCGCTACGTGTCCCAGAACGCGGAGGCGTTCGGCGGCACC
GGCTGGGCCGTCACCGAGTTCTCCTGGGACAACAAGTACGCCGGCCTCCAGGTCCTCCTC
TCCAAGGTCCTCTTCGAGCAGGGCGGCAGCGCCGCCGGCTACGCCGACACGCTGAAGCAG
TATCAGGCCAAGGCCGAGTTCTTCCTCTGCGCCTGCCTCCAGAAGAACAACGGCCACAAC
GTCAAGATGACCCCTGGTGGTCTCATGTACGTGAGCGACTGGAGCAACATGCAGTACGTG
AGCTCGTCGGCGTTCCTCCTCACCGTCTACGCCGACTACCTCGCCGAGTCGCGGGGAACG
CTCAGGTGCCCGGACGGCGAGGTGAAGCCGGCGGAGATCCTCCGGTTCGCGAGGTCGCAG
GTCGACTACGTCCTCGGCAAGAACCCCAAGGGGATGAGCTACATGGTCGGATACGGCAGC
TACTACCCGACGCACGTCCACCACCGCGGCGCGTCCATCCCGTCCATCTACGCCATGAAC
GCCACCGTCGGGTGCATGGAAAGCTTCGACAAGTACTACAACAGCAAGAACGCCGACCCC
AACGTCCTCCACGGCGCCCTCGTCGGCGGCCccgacgccaacgacgcctacgacgacgac
cgctgcaactaccagcacgccgagcccaccctcgccggcaacgcccccatgtccggcgtc
ttcgcccgcctcgccgcctcgcccgccgataacacgccggagtacacgccggcgCCAAAT
GCCCCCTCGCCATCAAATGGTGGGTCGCCGTTGGAGTTCGTGCACACGGTGACGAACACG
TGGAAGGCAAACGGCGTGGACTACTACCGGCACGTGGTGACGGCGAAGAACACGTGCGGC
CACGCCATCACCTACCTGAAGCTGCAGATCAAGGAGCTCTCCGGGGAGATCTACGGCGTC
TCCCGCACGAACGCCAAGGACATGTACGAGTTCCCGTCGTGGATGACACGGCTCGACGCC
GGCGCGCAGCTCACCATCGTCTACATCCAGGGCGGCCCCGCCGCCAAGATCGCCGTCGTC
GAGTACAAGACGGCCTGA

Protein

626 aa

>Os04t0674800-01 Similar to CEL1=CELLULASE 1 (Fragment).
MAATMNKTPATTFLLIPAAASLVLLLAAAASVEASAFDYAGAFDKCLLFFEAQRSGKLPD
DRLVRWRGDSALTDGFSQGVDLVGGYYDSGDHVKFGLPMAYAVTMLSWGVVEFEKEMVDG
NKLHRVLDAIRWGTNYFVKAHTQHNALWVQVGDGDSDHLCWERAEDMSTPRTAFKIDINN
PGSEVAGETAAALAAAAKAFKPYDRMYSDLLLLHSKQLFTFADTFRGKYDDSLQSAKKFY
PSASGYQDELLWAAAWLYEATGDEQYLRYVSQNAEAFGGTGWAVTEFSWDNKYAGLQVLL
SKVLFEQGGSAAGYADTLKQYQAKAEFFLCACLQKNNGHNVKMTPGGLMYVSDWSNMQYV
SSSAFLLTVYADYLAESRGTLRCPDGEVKPAEILRFARSQVDYVLGKNPKGMSYMVGYGS
YYPTHVHHRGASIPSIYAMNATVGCMESFDKYYNSKNADPNVLHGALVGGPDANDAYDDD
RCNYQHAEPTLAGNAPMSGVFARLAASPADNTPEYTPAPNAPSPSNGGSPLEFVHTVTNT
WKANGVDYYRHVVTAKNTCGHAITYLKLQIKELSGEIYGVSRTNAKDMYEFPSWMTRLDA
GAQLTIVYIQGGPAAKIAVVEYKTA*

5'UTR

chr04:34454312..34454341 (- strand) : 30 bp

CDS

chr04:34454075..34454311 (- strand) : 237 bp

chr04:34453604..34453816 (- strand) : 213 bp

chr04:34453315..34453515 (- strand) : 201 bp

chr04:34452247..34452631 (- strand) : 385 bp

chr04:34451251..34451793 (- strand) : 543 bp

chr04:34450870..34451168 (- strand) : 299 bp

3'UTR

chr04:34450562..34450869 (- strand) : 308 bp

FASTA

>Os04t0674800-01 class=Sequence position=chr04:34450562..34454341 (- strand)
AATCCAGTAT TCCACTACCG AGGTCGAGCA ATGGCGGCGA CGATGAACAA GACGCCGGCA ACCACCTTCC TGCTGATACC
GGCGGCGGCG TCGCTGGTTC TCCTCCTCGC GGCGGCCGCG TCGGTGGAGG CGTCGGCGTT CGACTACGCC GGCGCGTTCG
ACAAGTGCCT CCTGTTCTTC GAGGCGCAGC GCTCCGGCAA GCTCCCCGAC GACCGCCTCG TCCGGTGGCG CGGCGACTCC
GCCCTCACCG ACGGCTTCTC CCAGGGGGTA ATACATACAT CTCCGCCGCC TCCGGTTCAA TCAACCAAAT GCTCGATAGT
GGTTACAGTC GTTAGAgtag tactttaaag tcctgagttt aaatctttat agaagtaaat tttagattgt gttgtccacg
ggacaaagtt ctctattgca atggccgtgt atatccagtt ggatgtaaaa ggcaaggccg ggtaaaTGCT CGATCGGGTT
GAGTAATGCG GCGCGAATTG AATCGAAGGA TGGATGAATT TGCAGGTGGA TTTGGTGGGC GGGTACTACG ACTCCGGCGA
CCACGTGAAG TTCGGGCTCC CGATGGCGTA CGCGGTGACG ATGCTGTCGT GGGGGGTGGT CGAGTTCGAG AAGGAGATGG
TCGACGGCAA CAAGCTCCAC CGCGTCCTCG ACGCCATCCG CTGGGGCACC AACTACTTCG TCAAGGCCCA CACCCAGCAC
AACGCCCTCT GGGTCCAGGT ACGCACGCAC TCAAGGCCCA TCTCACCAAG AGCCCAACAC GGCCCACTAG TGCCCTCAAG
AAAAATTTTC TGGATTCTTT GATTAGGTGG GTGACGGCGA CAGCGACCAC CTGTGCTGGG AGCGCGCCGA GGACATGTCG
ACGCCGCGCA CGGCGTTCAA GATCGACATC AACAACCCCG GGTCGGAGGT CGCCGGCGAG ACCGCCGCCG CTCTCGCCGC
CGCCGCCAAG GCCTTCAAGC CCTACGACCG CATGTACTCC GACCTCCTCC TCCTCCACTC CAAGCAGGTA CAGAGACACA
TGTggctgtg atcttcgtcc atttttccaa cccaccttcc tcgtttttcg cacgcatgct tttcaaacta ttaaacggta
tgatttataa aaaaaaAgtg aattacgttt tgggccacat cttattacct aagtttcact ttagaccacc tttaaacata
tatttttact ttggaccgaa taaatttact attgttgtaa tttggattac cacgaacgat tttttttcag tacaaccaac
gagcttaaac acatcaactc tagtatgcgg ccgaactcct ctatatatgg ttcatatgtt tgccgaaagg gaagttatac
atgatgagaa aagttgttta tgatagtaca aaccgtaaca gtggtaaatt tacccagtct aaattaaaaa gatagcttta
agggtggtcc aaattgaaac ttgggaaata aaagagggac caaagtgcaa tttaATCTTA AAAAAATATA TATTAAAGTT
ATTTTAAAAA ATCATATTAA TCCATTTTTT TTAAAAAAAT AATTAATAGT TAATTAATTT TATAATAATA TAAGCTTTGT
TTTGCGGGAC GGGAGGAGGG GCTGTCGAAC GCAGCCAGCG TATGAGAGCA ATCAGCAAAT GCAGCAGCAA CATTCTGATG
AGTTATTTTC TCTTTTTTTT GGGGGGGCAG CTGTTCACGT TCGCGGACAC GTTCAGGGGC AAGTACGACG ACTCGCTGCA
GAGCGCCAAG AAGTTCTACC CGTCGGCGTC CGGCTACCAG GACGAGCTGC TGTGGGCGGC GGCGTGGCTG TACGAGGCGA
CCGGCGACGA GCAGTACCTC CGCTACGTGT CCCAGAACGC GGAGGCGTTC GGCGGCACCG GCTGGGCCGT CACCGAGTTC
TCCTGGGACA ACAAGTACGC CGGCCTCCAG GTCCTCCTCT CCAAGGTCCT CTTCGAGCAG GGCGGCAGCG CCGCCGGCTA
CGCCGACACG CTGAAGCAGT ATCAGGCCAA GGCCGAGTTC TTCCTCTGCG CCTGCCTCCA GAAGAACAAC GGCCACAACG
TCAAGATGAC CCCTGGTAAT CCATCCCATC CTTGCTAGCT TCTTCTTCTT CCAAGGATGG AAAACTCAAA TCATCCTTAA
GAAAACATCT CCTCATTTTT GCATGATCAt aaaaaaaatt agtaggatag atcactctta ataaatatac aaattcaaat
tcaattaata caaataaaaa caaaaataat aaatttgaca atgaatagaa cgtgtaattt aaggttaaat ttgttatttt
tgttttgaat tgtataagtt gaattttaac tcgcatgttt acgaaagatg tcatatatta atctatcttg acaatttttt
tttaaaaaaa aattgataaa attttgagtg agatgtataa aacgagggga tgtcctcccg agggacaaaa atccacttcc
TCGAAGAATT GGTAATAGAT TTTGCAATGT GATTGTTCTG AATTGTGTGG ATTGGATTGG TTATCCAGGT GGTCTCATGT
ACGTGAGCGA CTGGAGCAAC ATGCAGTACG TGAGCTCGTC GGCGTTCCTC CTCACCGTCT ACGCCGACTA CCTCGCCGAG
TCGCGGGGAA CGCTCAGGTG CCCGGACGGC GAGGTGAAGC CGGCGGAGAT CCTCCGGTTC GCGAGGTCGC AGGTCGACTA
CGTCCTCGGC AAGAACCCCA AGGGGATGAG CTACATGGTC GGATACGGCA GCTACTACCC GACGCACGTC CACCACCGCG
GCGCGTCCAT CCCGTCCATC TACGCCATGA ACGCCACCGT CGGGTGCATG GAAAGCTTCG ACAAGTACTA CAACAGCAAG
AACGCCGACC CCAACGTCCT CCACGGCGCC CTCGTCGGCG GCCccgacgc caacgacgcc tacgacgacg accgctgcaa
ctaccagcac gccgagccca ccctcgccgg caacgccccc atgtccggcg tcttcgcccg cctcgccgcc tcgcccgccg
ataacacgcc ggagtacacg ccggcgCCAA ATGCCCCCTC GCCATCAAAT GGTAATTAAT TAACCAAATC AACAATGCAA
TCGAACTTGT ACCATTGAGA TCTCCTCCAA GTGATCGTGC GTTTCTTTGT CAGGTGGGTC GCCGTTGGAG TTCGTGCACA
CGGTGACGAA CACGTGGAAG GCAAACGGCG TGGACTACTA CCGGCACGTG GTGACGGCGA AGAACACGTG CGGCCACGCC
ATCACCTACC TGAAGCTGCA GATCAAGGAG CTCTCCGGGG AGATCTACGG CGTCTCCCGC ACGAACGCCA AGGACATGTA
CGAGTTCCCG TCGTGGATGA CACGGCTCGA CGCCGGCGCG CAGCTCACCA TCGTCTACAT CCAGGGCGGC CCCGCCGCCA
AGATCGCCGT CGTCGAGTAC AAGACGGCCT GAGAATGGCA CGACGACGAC GACTGATTTC TGCCTTTCCT TTTTTCCATT
TTAGTTTTGG TGTGTGGTTG GCTGCTGCTT TTCAGCAAAC AGGTGGTGTG CAATCTCGAA GCAACGAGTC TGTGATGTCA
CCTCTGACCA CGACTGCTTT GAGATGTGGA CATGCACTGT TTCTTCTGTA CTTGGAATGG CATAGGAGAT CTCTCAGCTT
TTCTTTTAGC TTTCGTGATT TCTCCATTCT TTCCGCTGTG CACGCCTGTG TGTTTTATAT GTTCAAATTA AGCAGAAAAC
TGTGACATGA TGTTTTTGCT 

Locus: Os04g0674800

Loading...

Locus: Os04g0674800

Loading...