Os04t0675800-00

Locus

Os04g0675800

Description

Similar to H0103C06.10 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFbox238, Os_F0385

Oryzabase Gene Name Synonym(s)

F-box protein 238

Transcript Evidence

ab initio prediction

Protein Evidence

Q259H7 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

F-box domain, cyclin-like (IPR001810)

F-box domain, Skp2-like (IPR022364)

Expression Databases

TENOR (Os04t0675800-00)

Others

Oryzabase (17024)

Transcript

3360 bp

>Os04t0675800-00 Similar to H0103C06.10 protein.
ATGGCGATGCCGACGGTGGCCGCGGCGGCGGCGGTTGTCCCCGGGGTCGCATGTGGGTCC
TCGACGCGGCGTGTTGGGGTGGGAAATGGCAATGCGTCCGCACACGCCGGGGGTGGATGC
CTGGCTGGCGGACGGCGAGGGGCGGCCGCGTGGGTTGCGCGCGCGAGGGTGGCGGAGGCG
CCGCCGGTGGCCGCGGAGGGGAGCAGGCAGGAGGCCCCCGCCGCGCCGATGGTGGAGATC
CCCGTCACTTGCTATCAGATTCTTGGTGTTACAGAGAAGGCTGAGAAAGATGAGATTGTC
AAAGCAGCAATGGAGCTGAAAAATGCAGAAATTGAAGACGGGTACATGGCAGAGGTGTCT
ACCTGCAGACAGGCTCTGCTGGTAGATGTGAGAGACAAACTTCTCTTTGAACAGGAGTAC
GCAGGAAGCATAAAAGAAAAGCTTCCACCCAGATCCTCTCTTCATATACCTTGGAGTTGG
TTGCCTGCTGCACTTTGTGTCTTGCAGGAGGTTGGAGAAGAGAAGCTAGTTTTGGAAATT
GGTCAGGCGGCTCTACGACGCCCAGATTCTAGGCCATATGTTCATGATGTGCTTCTTGCA
ATGGCACTAGCTGAATGTTCTATTGCAAAAGCTAGCTTTGAGAAAAGTAAAGTGTCTCTT
GGCTTTGAAGCTCTAGCACGTGCTCAATACCTGTTGAGGAGAAAACCGTCTTTGGAGAAG
TTGCCCCTTCTTGAACAGATTGAAGAATCACTTGAAGAGCTTGCACCTGCTTGCACTCTG
GAGCTTCTAAGCTTACCTCAGACACCTGAAAACGCTGAACGCAGGCAGGGTGCTATTGCA
GCTCTCTGTGAACTGCTTAGACAGGGTCTTGACGTTGAATCCTCTTGTAGAGTTCATGAT
TGGCCTTGTTTCTTGGGCCAAGCAATGAATAAGTTGTTAGCCACTGAAATTGTGGATCTA
CTTTCTTGGGATACTTTGGCTACAACTCGTAAAAACAAAAAATCGTTGGAATCCCAGAGC
CAGCGGGCAGTAGTTGACTTCAATTGTTTCCATGTAGCGATGCTTGCTCACTTTGCGTTA
GGGTTTTCAACCCGGCAGGCTGACCTGGAATCTGGCACCACTGTTTTTGAAAAGCTTCAG
CAGCTTCAAAGTAATGGGAATTCCAACTCAAGAAATTATGGGTTACCTAAAAAGAAAGAC
GGCAATGACAAGGTTACTGTCTGTCAGTCTCTGGCCAACTTCTTTGGGGCTCCTAAGCGC
ATCCTTAGCACTTCCAAGCAGAAATTAGGAGCCACAAGAATGGTCCGTTTGAGTTCTCAG
CCATCTTCTAGTGTGTCACCATGCAACAGAGCTTTAGGGGAGCAGACGCCAAGATTAAAT
TCTACCAGCCATTTGGGGGAAGCTGTAAAGCAACTTGCACCAAACAACCTGGGGGTCCAT
TCTTCAATGGATAGGCCAGCAAATGGTTCAACCACAACATCTGTTCCCCTGAAGCGCAAT
CTTGTATCGCATCCTGCAAGAACCTTGGAATCGTGGGGTCTTACTGGTGATATTGTAGGG
AAACTTGCATATAGTGCACTCATTGGGTTTGCCCTATTTGGTACATTAAAACTGCTCAGA
CTTCAGTTTGGTCACATGAAACCTGCCTCCGCAAGTAGGGGTTCTGCTGCCACACAGTCC
CTGAATGAAGAATCGACGTTGGAAGGTTCTTTTATTACTAGCAGCGTCAGGAAACATTTT
GAAAAACTGCCCAAGATGCTTTGGTTAAACAATAGGCTTTATTCAAGAAGCGAAGAAAGC
GACCTATCTTCTGTTGCTAATGCAGTGGCTGCTACAGTATGCAAGCAAAGTATGGCTCTT
CAAGAAGCAGAAACACTTGTGAAGCAGTGGCAAGACATCAAATCTGAAGCTCTTGGCCCT
GATTATCAAATTGATATGCTCCCTGAAATTCTTGACGGTTCAATGCTTTCGAAGTGGCAA
GAGTTGGCATTGTCAGCAAAGGATCAGTCCTGCTATTGGAGATTTGTTTTGTTAAATCTC
TCTGTTGTTCGAGCGGAGATACTATTGGATGAGTCTGGCACTGGTGAAGTTGCAGAAATT
GGTGCTGTTCTTGAGGAAGCGGCTGAGCTTGTTGATGAATCCCAGCCCAAGAAGCCTAGC
TATTACAGCCACAACCAGAGCATGATGAGGAATTCAGAACAAGGCCTGCATGGGGGAATT
GTCAAAAGAAGAGAAGTACAAAAAATTTCACTTAGCAATCTCCCAATGGATATTTTAGCA
AAGATCTTGTCGCAGTTGCCAATAAATGACGCTATAAGGACAAGTGTATTGTCAAGAAAA
TGGAAATATTTTTGGTGCAGCCACACCAATCTTACTCTTAATAAAGGTACAATGAGGAAA
CCTTATGTCAAGACCTTGACTCCATATCGATGGCGATGGCTCAGGGACTACGAATTTATT
ACAAGGGTTGATGCGGTCCTGCGTCAGCACAGTGGAATGGGGGTTCAACGTATGGAAATT
AAGTTTCGGTTGCATAGTAAGCACGCAGACCATATTGATAGATGGGTGAACTTTGCAATT
GCATCAAAAACAAAGGAATTGGTTGTTGATTTATCAGGTCAGGATAAGGGCTCATTTTTC
ACAGATTTGACACATAGCAATTGCATACGGATAATCAAAGAACCACCATATAATTTGCCT
CCACAGCTTCTTGGCCTCAATTATGGTTCATACTTGCGGTGTCTCGAGCTTACGACCGTG
TCTCTGCAGCTGCCTGCTGATTTCAAAGGATTTCTGGACCTCAAGATTCTTAGCTTAGTA
GATATGAGCATTACAGATGAAGATGTTCAGCGTATGCTATCCAAATGCAATCTTCTGGAG
TTTTTGGAGATTTCATATTGCGAAATGGTTACTAGCATACGAATGCTTCATCCATTGGAC
CGGCTTAAGCATTTGGTAGTGGATATCTGCCCTAATCTGCAAGAGATAGAACTGAATTGT
AGTCCAACAACACTTAAGTACAGTGGCACCATGGTTCCTTTGATATTTGCTTCAACATCC
AGGCTGACAAATATTAGTATTGTATTCATCAATTACCAATCTGCTATTTCCTATATCATT
ACTGGATTCCCCAGTACTTTGCCAAGGCTCGAGACTCTGACCTTACATTGTGGAGAACGT
GAGAGAACTATCGTACCAGAAGGGCCTTTCAAATTTACTTATCTTCGGAATTTGAGGTTG
GAATTAGCTCTCTGTGGCCATGGAAATATCAGAAAGACTGATGCCCTTGATTATGCTTAT
ATCCTGAAGATTGCTCCTTTCATGGAAACACTGGAGTTGTCTATTGAAGTTAAGTCATGA

CDS

3360 bp

>Os04t0675800-00 Similar to H0103C06.10 protein.
ATGGCGATGCCGACGGTGGCCGCGGCGGCGGCGGTTGTCCCCGGGGTCGCATGTGGGTCC
TCGACGCGGCGTGTTGGGGTGGGAAATGGCAATGCGTCCGCACACGCCGGGGGTGGATGC
CTGGCTGGCGGACGGCGAGGGGCGGCCGCGTGGGTTGCGCGCGCGAGGGTGGCGGAGGCG
CCGCCGGTGGCCGCGGAGGGGAGCAGGCAGGAGGCCCCCGCCGCGCCGATGGTGGAGATC
CCCGTCACTTGCTATCAGATTCTTGGTGTTACAGAGAAGGCTGAGAAAGATGAGATTGTC
AAAGCAGCAATGGAGCTGAAAAATGCAGAAATTGAAGACGGGTACATGGCAGAGGTGTCT
ACCTGCAGACAGGCTCTGCTGGTAGATGTGAGAGACAAACTTCTCTTTGAACAGGAGTAC
GCAGGAAGCATAAAAGAAAAGCTTCCACCCAGATCCTCTCTTCATATACCTTGGAGTTGG
TTGCCTGCTGCACTTTGTGTCTTGCAGGAGGTTGGAGAAGAGAAGCTAGTTTTGGAAATT
GGTCAGGCGGCTCTACGACGCCCAGATTCTAGGCCATATGTTCATGATGTGCTTCTTGCA
ATGGCACTAGCTGAATGTTCTATTGCAAAAGCTAGCTTTGAGAAAAGTAAAGTGTCTCTT
GGCTTTGAAGCTCTAGCACGTGCTCAATACCTGTTGAGGAGAAAACCGTCTTTGGAGAAG
TTGCCCCTTCTTGAACAGATTGAAGAATCACTTGAAGAGCTTGCACCTGCTTGCACTCTG
GAGCTTCTAAGCTTACCTCAGACACCTGAAAACGCTGAACGCAGGCAGGGTGCTATTGCA
GCTCTCTGTGAACTGCTTAGACAGGGTCTTGACGTTGAATCCTCTTGTAGAGTTCATGAT
TGGCCTTGTTTCTTGGGCCAAGCAATGAATAAGTTGTTAGCCACTGAAATTGTGGATCTA
CTTTCTTGGGATACTTTGGCTACAACTCGTAAAAACAAAAAATCGTTGGAATCCCAGAGC
CAGCGGGCAGTAGTTGACTTCAATTGTTTCCATGTAGCGATGCTTGCTCACTTTGCGTTA
GGGTTTTCAACCCGGCAGGCTGACCTGGAATCTGGCACCACTGTTTTTGAAAAGCTTCAG
CAGCTTCAAAGTAATGGGAATTCCAACTCAAGAAATTATGGGTTACCTAAAAAGAAAGAC
GGCAATGACAAGGTTACTGTCTGTCAGTCTCTGGCCAACTTCTTTGGGGCTCCTAAGCGC
ATCCTTAGCACTTCCAAGCAGAAATTAGGAGCCACAAGAATGGTCCGTTTGAGTTCTCAG
CCATCTTCTAGTGTGTCACCATGCAACAGAGCTTTAGGGGAGCAGACGCCAAGATTAAAT
TCTACCAGCCATTTGGGGGAAGCTGTAAAGCAACTTGCACCAAACAACCTGGGGGTCCAT
TCTTCAATGGATAGGCCAGCAAATGGTTCAACCACAACATCTGTTCCCCTGAAGCGCAAT
CTTGTATCGCATCCTGCAAGAACCTTGGAATCGTGGGGTCTTACTGGTGATATTGTAGGG
AAACTTGCATATAGTGCACTCATTGGGTTTGCCCTATTTGGTACATTAAAACTGCTCAGA
CTTCAGTTTGGTCACATGAAACCTGCCTCCGCAAGTAGGGGTTCTGCTGCCACACAGTCC
CTGAATGAAGAATCGACGTTGGAAGGTTCTTTTATTACTAGCAGCGTCAGGAAACATTTT
GAAAAACTGCCCAAGATGCTTTGGTTAAACAATAGGCTTTATTCAAGAAGCGAAGAAAGC
GACCTATCTTCTGTTGCTAATGCAGTGGCTGCTACAGTATGCAAGCAAAGTATGGCTCTT
CAAGAAGCAGAAACACTTGTGAAGCAGTGGCAAGACATCAAATCTGAAGCTCTTGGCCCT
GATTATCAAATTGATATGCTCCCTGAAATTCTTGACGGTTCAATGCTTTCGAAGTGGCAA
GAGTTGGCATTGTCAGCAAAGGATCAGTCCTGCTATTGGAGATTTGTTTTGTTAAATCTC
TCTGTTGTTCGAGCGGAGATACTATTGGATGAGTCTGGCACTGGTGAAGTTGCAGAAATT
GGTGCTGTTCTTGAGGAAGCGGCTGAGCTTGTTGATGAATCCCAGCCCAAGAAGCCTAGC
TATTACAGCCACAACCAGAGCATGATGAGGAATTCAGAACAAGGCCTGCATGGGGGAATT
GTCAAAAGAAGAGAAGTACAAAAAATTTCACTTAGCAATCTCCCAATGGATATTTTAGCA
AAGATCTTGTCGCAGTTGCCAATAAATGACGCTATAAGGACAAGTGTATTGTCAAGAAAA
TGGAAATATTTTTGGTGCAGCCACACCAATCTTACTCTTAATAAAGGTACAATGAGGAAA
CCTTATGTCAAGACCTTGACTCCATATCGATGGCGATGGCTCAGGGACTACGAATTTATT
ACAAGGGTTGATGCGGTCCTGCGTCAGCACAGTGGAATGGGGGTTCAACGTATGGAAATT
AAGTTTCGGTTGCATAGTAAGCACGCAGACCATATTGATAGATGGGTGAACTTTGCAATT
GCATCAAAAACAAAGGAATTGGTTGTTGATTTATCAGGTCAGGATAAGGGCTCATTTTTC
ACAGATTTGACACATAGCAATTGCATACGGATAATCAAAGAACCACCATATAATTTGCCT
CCACAGCTTCTTGGCCTCAATTATGGTTCATACTTGCGGTGTCTCGAGCTTACGACCGTG
TCTCTGCAGCTGCCTGCTGATTTCAAAGGATTTCTGGACCTCAAGATTCTTAGCTTAGTA
GATATGAGCATTACAGATGAAGATGTTCAGCGTATGCTATCCAAATGCAATCTTCTGGAG
TTTTTGGAGATTTCATATTGCGAAATGGTTACTAGCATACGAATGCTTCATCCATTGGAC
CGGCTTAAGCATTTGGTAGTGGATATCTGCCCTAATCTGCAAGAGATAGAACTGAATTGT
AGTCCAACAACACTTAAGTACAGTGGCACCATGGTTCCTTTGATATTTGCTTCAACATCC
AGGCTGACAAATATTAGTATTGTATTCATCAATTACCAATCTGCTATTTCCTATATCATT
ACTGGATTCCCCAGTACTTTGCCAAGGCTCGAGACTCTGACCTTACATTGTGGAGAACGT
GAGAGAACTATCGTACCAGAAGGGCCTTTCAAATTTACTTATCTTCGGAATTTGAGGTTG
GAATTAGCTCTCTGTGGCCATGGAAATATCAGAAAGACTGATGCCCTTGATTATGCTTAT
ATCCTGAAGATTGCTCCTTTCATGGAAACACTGGAGTTGTCTATTGAAGTTAAGTCATGA

Protein

1120 aa

>Os04t0675800-00 Similar to H0103C06.10 protein.
MAMPTVAAAAAVVPGVACGSSTRRVGVGNGNASAHAGGGCLAGGRRGAAAWVARARVAEA
PPVAAEGSRQEAPAAPMVEIPVTCYQILGVTEKAEKDEIVKAAMELKNAEIEDGYMAEVS
TCRQALLVDVRDKLLFEQEYAGSIKEKLPPRSSLHIPWSWLPAALCVLQEVGEEKLVLEI
GQAALRRPDSRPYVHDVLLAMALAECSIAKASFEKSKVSLGFEALARAQYLLRRKPSLEK
LPLLEQIEESLEELAPACTLELLSLPQTPENAERRQGAIAALCELLRQGLDVESSCRVHD
WPCFLGQAMNKLLATEIVDLLSWDTLATTRKNKKSLESQSQRAVVDFNCFHVAMLAHFAL
GFSTRQADLESGTTVFEKLQQLQSNGNSNSRNYGLPKKKDGNDKVTVCQSLANFFGAPKR
ILSTSKQKLGATRMVRLSSQPSSSVSPCNRALGEQTPRLNSTSHLGEAVKQLAPNNLGVH
SSMDRPANGSTTTSVPLKRNLVSHPARTLESWGLTGDIVGKLAYSALIGFALFGTLKLLR
LQFGHMKPASASRGSAATQSLNEESTLEGSFITSSVRKHFEKLPKMLWLNNRLYSRSEES
DLSSVANAVAATVCKQSMALQEAETLVKQWQDIKSEALGPDYQIDMLPEILDGSMLSKWQ
ELALSAKDQSCYWRFVLLNLSVVRAEILLDESGTGEVAEIGAVLEEAAELVDESQPKKPS
YYSHNQSMMRNSEQGLHGGIVKRREVQKISLSNLPMDILAKILSQLPINDAIRTSVLSRK
WKYFWCSHTNLTLNKGTMRKPYVKTLTPYRWRWLRDYEFITRVDAVLRQHSGMGVQRMEI
KFRLHSKHADHIDRWVNFAIASKTKELVVDLSGQDKGSFFTDLTHSNCIRIIKEPPYNLP
PQLLGLNYGSYLRCLELTTVSLQLPADFKGFLDLKILSLVDMSITDEDVQRMLSKCNLLE
FLEISYCEMVTSIRMLHPLDRLKHLVVDICPNLQEIELNCSPTTLKYSGTMVPLIFASTS
RLTNISIVFINYQSAISYIITGFPSTLPRLETLTLHCGERERTIVPEGPFKFTYLRNLRL
ELALCGHGNIRKTDALDYAYILKIAPFMETLELSIEVKS*

CDS

chr04:34512883..34513140 (- strand) : 258 bp

chr04:34512512..34512625 (- strand) : 114 bp

chr04:34512259..34512396 (- strand) : 138 bp

chr04:34511667..34511771 (- strand) : 105 bp

chr04:34511467..34511589 (- strand) : 123 bp

chr04:34511018..34511386 (- strand) : 369 bp

chr04:34510648..34510773 (- strand) : 126 bp

chr04:34509635..34510375 (- strand) : 741 bp

chr04:34509348..34509541 (- strand) : 194 bp

chr04:34507419..34507518 (- strand) : 100 bp

chr04:34506362..34507276 (- strand) : 915 bp

chr04:34506112..34506270 (- strand) : 159 bp

chr04:34505859..34505876 (- strand) : 18 bp

FASTA

>Os04t0675800-00 class=Sequence position=chr04:34505859..34513140 (- strand)
ATGGCGATGC CGACGGTGGC CGCGGCGGCG GCGGTTGTCC CCGGGGTCGC ATGTGGGTCC TCGACGCGGC GTGTTGGGGT
GGGAAATGGC AATGCGTCCG CACACGCCGG GGGTGGATGC CTGGCTGGCG GACGGCGAGG GGCGGCCGCG TGGGTTGCGC
GCGCGAGGGT GGCGGAGGCG CCGCCGGTGG CCGCGGAGGG GAGCAGGCAG GAGGCCCCCG CCGCGCCGAT GGTGGAGATC
CCCGTCACTT GCTATCAGGT TTTTTTTTTT TTTGGCCACT CGTACTGTTT ATGGATCCGA ATTTTGGAAA TGTGGTCTTA
TATCGTCGAT GGATCTAGTT TAGCTCGGCT GGTCTCTGTT CGAATGATAC AGTTGCAGAT TAGATAGTCG TTTCTTGACC
ATAATTCAAC TTTAGTGTTT GCACCACGAT GCCTATTGTA ATTTGCACTG GTAGTTCACA CGCGTGACAC GCCTCCCTGA
TTTTTGGAGT GACATGTTTC AAATGGCCAA TGCAGATTCT TGGTGTTACA GAGAAGGCTG AGAAAGATGA GATTGTCAAA
GCAGCAATGG AGCTGAAAAA TGCAGAAATT GAAGACGGGT ACATGGCAGA GGTGTCTACC TGCAGACAGG TTGCTCGCTG
AATCAAGGAA TTCTGGAAAT ATATTTGGAT ATACTGCTTT GTTTAATGTA GGGAATGCAG AATTCATGTG GTTAATCTTT
GCTTATTTCT TTCATGTTTG GTAGGCTCTG CTGGTAGATG TGAGAGACAA ACTTCTCTTT GAACAGGAGT ACGCAGGAAG
CATAAAAGAA AAGCTTCCAC CCAGATCCTC TCTTCATATA CCTTGGAGTT GGTTGCCTGC TGCACTTTGT GTCTTGCAGG
AGGTAATGTG TAACACAGAC ATCCTTATTA TTGTGAACAA ATAAAGGAAA ACCACCAAGT TTGGTTTAGG TTTGTCACCT
TTTATGTTAC ATGACATAGT CATAGTCGTC ACCATGACCA TGCCCGGTAT GTTTCTTTAT AGGTCTGCCT TATTCTTTGT
CAGAATACTA TTCTCAATTC ACTGAATGAT TTGAAAGGGA TCAAGAAGAT TTAGGATCAA TAATGTTTAA CTAATAAAGA
AAACTTTTAT GCTAACTTCA GGGTAAATTA TCCTTAGGAA TGTGGTGAGG AGCGCGTAGG TTTTAAACTT TGCCCTTTCT
TAGGACTGGG TAGCGTAAAA TGCAGGGGAT GCAGGTTAGT CACCATTATG ATGTTTGTGA GTTCTAAGTG ATCATGAATA
CAAGACACCT AGCAGCTTGA ATTTATTAAA ATTGAATGTA CCATTATCAT AATGAAATGG TGTATTACAT GCTACAATAT
TCATTTCAGG TTGGAGAAGA GAAGCTAGTT TTGGAAATTG GTCAGGCGGC TCTACGACGC CCAGATTCTA GGCCATATGT
TCATGATGTG CTTCTTGCAA TGGCACTAGC TGAAGTAAGA AGCACACAAA ATTTTAAATA ACTGACTACA AATTGGTATA
TTTTGCAATG ATTTGATGCA TTTTCTTGTA GTGTTCTATT GCAAAAGCTA GCTTTGAGAA AAGTAAAGTG TCTCTTGGCT
TTGAAGCTCT AGCACGTGCT CAATACCTGT TGAGGAGAAA ACCGTCTTTG GAGAAGTTGC CCCTTCTTGA ACAGGTTAAT
TTTTGTTGTT ATCGCTCTAC AGATTCTTCT ACATGTAGAA TTATGCCCTT AACTTATTTC ATTGGATGAA CTAGATTGAA
GAATCACTTG AAGAGCTTGC ACCTGCTTGC ACTCTGGAGC TTCTAAGCTT ACCTCAGACA CCTGAAAACG CTGAACGCAG
GCAGGGTGCT ATTGCAGCTC TCTGTGAACT GCTTAGACAG GGTCTTGACG TTGAATCCTC TTGTAGAGTT CATGATTGGC
CTTGTTTCTT GGGCCAAGCA ATGAATAAGT TGTTAGCCAC TGAAATTGTG GATCTACTTT CTTGGGATAC TTTGGCTACA
ACTCGTAAAA ACAAAAAATC GTTGGAATCC CAGAGCCAGC GGGCAGTAGT TGACTTCAAT TGTTTCCATG TAGCGATGCT
TGCTCACTTT GCGTTAGGGT TTTCAACCCG GCAGGCTGAC CTGGTACCTT CTCCTTCTCA ATAGTAGTAA ACTATCATTT
TTGCTATTTA TGCATTATTT AACGTACAGT TCCTTTATGC AGATCAGTAA AGCCAAAACC ATTTGCGATT GTTTAGTTGC
ATCTGAAAAC ACAGACCTGA AATTTGAGGA ATCATTTTGT TTGTATCTCC TTGGAGAGGT GATAAGCTGA TTTGAACTGC
AAAAATTTTA CTAGTTTACA TTATCATAAC TAAATGTTTG CTCTCAGGAA TCTGGCACCA CTGTTTTTGA AAAGCTTCAG
CAGCTTCAAA GTAATGGGAA TTCCAACTCA AGAAATTATG GGTTACCTAA AAAGAAAGAC GGCAATGACA AGGTTACTGT
CTGTCAGTCT CTGGTATGTT ATATTTCACT GTAGTATGTT TTGGAGCAAA TAAATTGTGC TACTGTAGAT TACTGAATAT
TATATTTCTC CATTGTGTTA AAATTTTCTC ATGGCAAATA GCGTATCTTT ACAGGAATTG TGGCTGAAGG ATATGGCACT
TTCTCGTTTT GCGGATACAA GAGATTGTTC ACCATCTTTG GTCTGTGTCT TACTATTTTC AGTAATGAAA CCCATGAATA
TTTTTTTCTA CAGACTAATT TCATATCATT ATTCTCTTAC GGCAGGCCAA CTTCTTTGGG GCTCCTAAGC GCATCCTTAG
CACTTCCAAG CAGAAATTAG GAGCCACAAG AATGGTCCGT TTGAGTTCTC AGCCATCTTC TAGTGTGTCA CCATGCAACA
GAGCTTTAGG GGAGCAGACG CCAAGATTAA ATTCTACCAG CCATTTGGGG GAAGCTGTAA AGCAACTTGC ACCAAACAAC
CTGGGGGTCC ATTCTTCAAT GGATAGGCCA GCAAATGGTT CAACCACAAC ATCTGTTCCC CTGAAGCGCA ATCTTGTATC
GCATCCTGCA AGAACCTTGG AATCGTGGGG TCTTACTGGT GATATTGTAG GGAAACTTGC ATATAGTGCA CTCATTGGGT
TTGCCCTATT TGGTACATTA AAACTGCTCA GACTTCAGTT TGGTCACATG AAACCTGCCT CCGCAAGTAG GGGTTCTGCT
GCCACACAGT CCCTGAATGA AGAATCGACG TTGGAAGGTT CTTTTATTAC TAGCAGCGTC AGGAAACATT TTGAAAAACT
GCCCAAGATG CTTTGGTTAA ACAATAGGCT TTATTCAAGA AGCGAAGAAA GCGACCTATC TTCTGTTGCT AATGCAGTGG
CTGCTACAGT ATGCAAGCAA AGTATGGCTC TTCAAGAAGC AGAAACACTT GTGAAGCAGT GGCAAGACAT CAAATCTGAA
GCTCTTGGCC CTGATTATCA AATTGATATG CTCCCTGAAA TTCTTGACGG TTCAATGCTT TCGAAGGTAA TTTCCTTTTT
ATCCATGGTG TACTTACATA TAGACTTCCA TGTTTAAATA TTTGAATTGT CCATAATGGA AGACCTACTT GTCGAGCAGT
GGCAAGAGTT GGCATTGTCA GCAAAGGATC AGTCCTGCTA TTGGAGATTT GTTTTGTTAA ATCTCTCTGT TGTTCGAGCG
GAGATACTAT TGGATGAGTC TGGCACTGGT GAAGTTGCAG AAATTGGTGC TGTTCTTGAG GAAGCGGCTG AGCTTGTTGA
TGAATCCCAG CCCAAGAAGC CTAGCTATTA CAGGTAATTC AGAAGATAAT GTTTCTATTT ATCACGCTTT CCTGTTGTGC
TCTAAAGTAA CACGGTACTG ATACTTTATA CTGTTACAAT TGCAGTATGT ATGAAGTTCA GTACATATTG AGGAGACAGA
GTGATGGATC TTGGAAAATC TGTGAGGCTT CTGTACGGGA CTTGACATGA TTATTGTCAA AAGAGACAAC TTATTCATCG
GCTGATAGCT CACAGGGCGC TGTTAATTTT ATAAGGTTCG ACATGGCTGG CTCTGTTAAT TTTACAAGGT TCGACACGGC
TGGCTTGATA CGCCATTAAA TCAATTTGAG GTATCTTGCA ATGGCTTGCG ATGCCCGAGC TGCTCATGGT GGCCACCGGA
TACCTTACAT GACAAAGTAG CTGCTGATAG CCTGATATGC CACATTTGTA CAGACTCTAA CCAAACCTGA TATCACATGC
TTTTATCTGT TTCCTGATAT GGTTTGAATT TGCGGGACCT TTTTTAGTCG TGCCCTTTTT TAGTTGTGCG AGAGGCCATC
TGCGTCTAAA TTGTGGCGCC ATTGTTCAAA GAACAATGTA AATTAATCTG CTCCTGTGTC TGTGTGGTTG TGTTCAACGG
TAAAATTCAT GCTCCGCTAT TCATCCTTGT TAAATTCCTA CATTAAGATC TCTGCTAGAT CTATGCTTAA GAAACTTGTC
AAGTTGAGGG ATTGAATAAA CAGAGCAAAC TGTCCCTAAC CCTGAAATAT TCTGGTGGCC ACAGGCGAGC TCAATGGCAA
GAGCACCCAT GCTGGGTTTC GGAATTCTGA CTGTTTACAA GTTCAGTTTC TTTTCTGAAA TCCCTGAAGC TGCAGTATGC
GTCAGAAAGT ATCACCAATG ACCATCTACA GTTTAAAAAA AAAATCTCAT CAGGTACCGG AGGATTTATA TGTAGGAGTA
ACCAATCTCC TAGCTCATTG ATCTCTCGTA GCCTCAATTT CTCGTTCATT GATCTCTCGT AGTCTCATTC AGAGACTATA
TTCTTGACGT TAAAAAAAAA ACAGAATCGG GAACAGAATC TCTCCCTCGC GCACGGGGAG AGGAAACAGA ATCGGAAGCG
AAGTTGTGGA GGAAGCGGAG TACATAATAC TAATCTCTAC TTCTCACCTC CTCTTTTCTT TCTCcctcct tgacctgctc
tgtctcgtgg cgtgggctac gacgacagcg cgaccggcgc cgctttcgca cgtcttggtc gggaccttcg ccggcgacga
gcatccacta ggtTTTTACC CTTCACTTCT TGTATGTACA CCACCCTATA AGGTGAGATG CCCTTCCAAT GGAGTGCACC
CATCCAATCC AATGGGGGTT GGGGGGCTCT TATTTTAGCT AGCCCATCCG AGACACAATA ATGTGCTGCT GTTCTTCAAT
TCATCCACAA TATATCATCT AACTACAATT CAAGCAGCCA ATCAACTATC ATTATAGTCC ATTCATCACA TTGGAATAAG
GGCTCAAAAA GTAGTTTAGC CATGTTGGTT ATGGTCCTGT ATCGATAAGC TTTTATACAT ATAAAAAGAA ACATACAAAA
AAACAGAGTT GACATAAAAC ACTGAAATTC TTTTATATAA GAGAAAACAT CTTTCAAACT ATGTTCTCCT TTACAAAGTA
ATAAGGGTAC ATCGTACATG CCCTGACAGA CTCTTTTTTT CCTATCATGT AACAAAGTTG AAATACTCAT CTGAGTCGTT
ACCTTAAGAT TATCAATTCC ATGAAATTAT TTTTTTCTAG TGCTTGATGT TCTTGTATGT ACTGAACAGT AGGACGGCTC
TTCTTTACTG AAAAGAGTTC AGCCACAACC AGAGCATGAT GAGGAATTCA GAACAAGGCC TGCATGGGGG AATTGTCAAA
AGAAGAGAAG TACAAAAAAT TTCACTTAGC AATCTCCCAA TGGTATGTGA GTTCATACAG AAATTAAGTG TAAGACAATG
TGTTTTCACG TATTAATATG ATGAATCTTG TACAGCGATG GTATCTATTT AGCTGTTTAT GTCAAATACT TAAATTATTA
TAATGCTGTT GTTTCCTGAT GTAGGATATT TTAGCAAAGA TCTTGTCGCA GTTGCCAATA AATGACGCTA TAAGGACAAG
TGTATTGTCA AGAAAATGGA AATATTTTTG GTGCAGCCAC ACCAATCTTA CTCTTAATAA AGGTACAATG AGGAAACCTT
ATGTCAAGAC CTTGACTCCA TATCGATGGC GATGGCTCAG GGACTACGAA TTTATTACAA GGGTTGATGC GGTCCTGCGT
CAGCACAGTG GAATGGGGGT TCAACGTATG GAAATTAAGT TTCGGTTGCA TAGTAAGCAC GCAGACCATA TTGATAGATG
GGTGAACTTT GCAATTGCAT CAAAAACAAA GGAATTGGTT GTTGATTTAT CAGGTCAGGA TAAGGGCTCA TTTTTCACAG
ATTTGACACA TAGCAATTGC ATACGGATAA TCAAAGAACC ACCATATAAT TTGCCTCCAC AGCTTCTTGG CCTCAATTAT
GGTTCATACT TGCGGTGTCT CGAGCTTACG ACCGTGTCTC TGCAGCTGCC TGCTGATTTC AAAGGATTTC TGGACCTCAA
GATTCTTAGC TTAGTAGATA TGAGCATTAC AGATGAAGAT GTTCAGCGTA TGCTATCCAA ATGCAATCTT CTGGAGTTTT
TGGAGATTTC ATATTGCGAA ATGGTTACTA GCATACGAAT GCTTCATCCA TTGGACCGGC TTAAGCATTT GGTAGTGGAT
ATCTGCCCTA ATCTGCAAGA GATAGAACTG AATTGTAGTC CAACAACACT TAAGTACAGT GGCACCATGG TTCCTTTGAT
ATTTGCTTCA ACATCCAGGC TGACAAATAT TAGTATTGTA TTCATCAATT ACCAATCTGC TATTTCCTAT ATCATTACTG
GATTCCCCAG TACTTTGCCA AGGCTCGAGA CTCTGACCTT ACATTGTGGA GAACGTGAGG TTCGTGATAT GTCGTCCTTT
GTGGCCATAT TTTGTGCATA TATCACTATA AGATCAAATT CACCAATTTT TTTTTTCATT TCTGTTGCAG AGAACTATCG
TACCAGAAGG GCCTTTCAAA TTTACTTATC TTCGGAATTT GAGGTTGGAA TTAGCTCTCT GTGGCCATGG AAATATCAGA
AAGACTGATG CCCTTGATTA TGCTTATATC CTGAAGATTG CTCCTTTCAT GGAAACACTG GAGTTGTCTG TAAGTTTATT
TCATTGTGGC TTCGCAAACA GATTTCGTAA GTTGTGGAAA AAAAAAAATG CCAATGACAA TAAAATTACA AGAATAGTGA
TCTATTTATG TTATCTGTTG GGGCAGTTGG TAATGCTAAA AAGCGCATAG TGACATGCAG TAGTTTATTT CTTAACTTTT
TTATTGAATA GAATATTTGA TTCTGTCTTT TGCGCATATG AGCATACCTA AAACTTTGGT TCAGATTGAA GTTAAGTCAT
GA

Locus: Os04g0675800

Loading...

Locus: Os04g0675800

Loading...