Os04t0678400-01

Locus

Os04g0678400

Description

Zinc finger, Dof-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

DOF17

CGSNL Gene Name

DNA BINDING WITH ONE FINGER 17

Oryzabase Gene Symbol Synonym(s)

OsDof17, Dof17, OsDof-17

Oryzabase Gene Name Synonym(s)

Dof zinc factor 17, Dof transcription factor 17

Transcript Evidence

AK107524 (DDBJ, Best hit)

Protein Evidence

Q259D3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, Dof-type (IPR003851)

Full-length cDNA

002-129-F12 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0678400-01)

RiceXPro (AK107524)

Others

Oryzabase (8807)

KEGG (Os04t0678400-01)

Transcript

1096 bp

>Os04t0678400-01 Zinc finger, Dof-type domain containing protein.
CTCCCGAGAGAGACGATCGAGATCACGCGCCCACAGAAACTGCAGATTAAGCGGCAGAGA
TTGTAGATAGCGCGAGGTTATTAAGGCCAGCAGTCTGACCGCGCGCGGCATGCCCTTCTG
CTGCTGCAACCGACCAAATGGCTCCTGCGGTTGCCTCCTCCCCGTCACTCGTGCTCTCCG
CCGCCGCCGCCACCGCCTCCAACAAGCGCCCGGCCGATTCCGACGCCTCGCCGCCGCACC
AGGGAGATCGCACGGGGCAGCAGGAGAAGAAGCAGCAGCAGCTGGAGTGCCCGCGCTGCC
GATCCACCAACACCAAGTTCTGCTACTACAACAACTACAGCACGTCGCAGCCGCGCCACT
TCTGCCGCGCCTGCCGCCGCTACTGGACGCACGGGGGCACGCTCCGCGACGTGCCGGTGG
GCGGCGCCTCTCGCCGCGGCGGCGGCGGCAAGCGCCGCAGGGTCTCCGCCGACGCCGACC
CTTCCTCGGCGTCGCCGCCGCCACCCACGACTTCCACCACGGACGCGTACGCCGACCTCC
CAGCCGGCTTCCCGTTCCTCAGTGACGGCGCCTTCCTGCCGCAGTTCGGCCTCGCCGGCG
TTGCGCCGGCCGCGTTCTCTTGGGCATCGGCTGTCCCTGACTTGTACAACTGCGGGATCG
CGCCGTGGGACGATGGAACGGCGGTCACCGGCGCGGCGTGGGACAACTTCGCCGACATCG
CCGGCCTTGATCTCAGCTGGCCGCCGCCGGGTAACTGACGAACAGTACACAGCTGGTCGC
TCGTGTTTTGGGGGGCTCCGGTTTTAGCAAAGCAGCCTCAAGTAGTGCGTTCTTCGATCG
GTATGCAGGTAGTGTGTTCTTCGATCGGTATGAAGTATATTTTGCTGAGCTAGGGATTAT
GATATAATTATTGGGAATGTAATTAAGCAGCTCAATTATCCAACGTGGTGTTTGCAGTTT
TCTTCTCTCACCAATTTCATACGCTTGCACAATGATGTGGTGATTATCATTGGGATCAGT
GAATCGTGATCTGTAGCTGGAAGATGTGTTTACGTATGTGCAGTGTTAATGACAATAATA
AGAGTTTGTTGCCATC

CDS

621 bp

>Os04t0678400-01 Zinc finger, Dof-type domain containing protein.
ATGGCTCCTGCGGTTGCCTCCTCCCCGTCACTCGTGCTCTCCGCCGCCGCCGCCACCGCC
TCCAACAAGCGCCCGGCCGATTCCGACGCCTCGCCGCCGCACCAGGGAGATCGCACGGGG
CAGCAGGAGAAGAAGCAGCAGCAGCTGGAGTGCCCGCGCTGCCGATCCACCAACACCAAG
TTCTGCTACTACAACAACTACAGCACGTCGCAGCCGCGCCACTTCTGCCGCGCCTGCCGC
CGCTACTGGACGCACGGGGGCACGCTCCGCGACGTGCCGGTGGGCGGCGCCTCTCGCCGC
GGCGGCGGCGGCAAGCGCCGCAGGGTCTCCGCCGACGCCGACCCTTCCTCGGCGTCGCCG
CCGCCACCCACGACTTCCACCACGGACGCGTACGCCGACCTCCCAGCCGGCTTCCCGTTC
CTCAGTGACGGCGCCTTCCTGCCGCAGTTCGGCCTCGCCGGCGTTGCGCCGGCCGCGTTC
TCTTGGGCATCGGCTGTCCCTGACTTGTACAACTGCGGGATCGCGCCGTGGGACGATGGA
ACGGCGGTCACCGGCGCGGCGTGGGACAACTTCGCCGACATCGCCGGCCTTGATCTCAGC
TGGCCGCCGCCGGGTAACTGA

Protein

207 aa

>Os04t0678400-01 Zinc finger, Dof-type domain containing protein.
MAPAVASSPSLVLSAAAATASNKRPADSDASPPHQGDRTGQQEKKQQQLECPRCRSTNTK
FCYYNNYSTSQPRHFCRACRRYWTHGGTLRDVPVGGASRRGGGGKRRRVSADADPSSASP
PPPTTSTTDAYADLPAGFPFLSDGAFLPQFGLAGVAPAAFSWASAVPDLYNCGIAPWDDG
TAVTGAAWDNFADIAGLDLSWPPPGN*

5'UTR

chr04:34656599..34656735 (- strand) : 137 bp

CDS

chr04:34656494..34656598 (- strand) : 105 bp

chr04:34655654..34656169 (- strand) : 516 bp

3'UTR

chr04:34655316..34655653 (- strand) : 338 bp

FASTA

>Os04t0678400-01 class=Sequence position=chr04:34655316..34656735 (- strand)
CTCCCGAGAG AGACGATCGA GATCACGCGC CCACAGAAAC TGCAGATTAA GCGGCAGAGA TTGTAGATAG CGCGAGGTTA
TTAAGGCCAG CAGTCTGACC GCGCGCGGCA TGCCCTTCTG CTGCTGCAAC CGACCAAATG GCTCCTGCGG TTGCCTCCTC
CCCGTCACTC GTGCTCTCCG CCGCCGCCGC CACCGCCTCC AACAAGCGCC CGGCCGATTC CGACGCCTCG CCGCCGCACC
AGGTCAGTTA ATTACTCGGT TACATACTTA ATTACACTTG CAGATGCAGT TGCATATTAG CTGTGGAAGT GTGTagggat
atacgtggtt tttagctagt gttgctgttt ctggagattt gttgagaatg tagcgtggct cgctctttct actttctaga
gtttgtgttT AGCCgttctc tggcataagt cggtctgact gattgtgttg tgtaactaca atttttttat tctaatatac
tacgtgtaat cttttttgcg tgttcacgaa aaAAATGAAG TGCGTAGGGA TCGGCCAGTG ATGTGGATGT GGTTTTTGAT
TTGCAGGGAG ATCGCACGGG GCAGCAGGAG AAGAAGCAGC AGCAGCTGGA GTGCCCGCGC TGCCGATCCA CCAACACCAA
GTTCTGCTAC TACAACAACT ACAGCACGTC GCAGCCGCGC CACTTCTGCC GCGCCTGCCG CCGCTACTGG ACGCACGGGG
GCACGCTCCG CGACGTGCCG GTGGGCGGCG CCTCTCGCCG CGGCGGCGGC GGCAAGCGCC GCAGGGTCTC CGCCGACGCC
GACCCTTCCT CGGCGTCGCC GCCGCCACCC ACGACTTCCA CCACGGACGC GTACGCCGAC CTCCCAGCCG GCTTCCCGTT
CCTCAGTGAC GGCGCCTTCC TGCCGCAGTT CGGCCTCGCC GGCGTTGCGC CGGCCGCGTT CTCTTGGGCA TCGGCTGTCC
CTGACTTGTA CAACTGCGGG ATCGCGCCGT GGGACGATGG AACGGCGGTC ACCGGCGCGG CGTGGGACAA CTTCGCCGAC
ATCGCCGGCC TTGATCTCAG CTGGCCGCCG CCGGGTAACT GACGAACAGT ACACAGCTGG TCGCTCGTGT TTTGGGGGGC
TCCGGTTTTA GCAAAGCAGC CTCAAGTAGT GCGTTCTTCG ATCGGTATGC AGGTAGTGTG TTCTTCGATC GGTATGAAGT
ATATTTTGCT GAGCTAGGGA TTATGATATA ATTATTGGGA ATGTAATTAA GCAGCTCAAT TATCCAACGT GGTGTTTGCA
GTTTTCTTCT CTCACCAATT TCATACGCTT GCACAATGAT GTGGTGATTA TCATTGGGAT CAGTGAATCG TGATCTGTAG
CTGGAAGATG TGTTTACGTA TGTGCAGTGT TAATGACAAT AATAAGAGTT TGTTGCCATC 

Locus: Os04g0678400

Loading...

Locus: Os04g0678400

Loading...