Os04t0683400-00

Locus

Os04g0683400

Description

Similar to H0306F12.4 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP5G

CGSNL Gene Name

HAP5G SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP5G, NF-YC, CBF-C, OsNF-YC3, Os-NF-YC3, NF-YC3, NFYC3

Oryzabase Gene Name Synonym(s)

Nuclear factor Y C3 subunit, Nuclear factor Y C subunit 3, NUCLEAR FACTOR-Y subunit C3, NUCLEAR FACTOR-Y subunit NF-YC3, NF-YC subunit 3, NF-YC family 3

Transcript Evidence

EU958236 (DDBJ)

Protein Evidence

Q259Q7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Expression Databases

TENOR (Os04t0683400-00)

Others

Oryzabase (8497)

KEGG (Os04t0683400-00)

Transcript

378 bp

>Os04t0683400-00 Similar to H0306F12.4 protein.
ATGAGGCAGGCGAGGCCCTACTCGGCGATGTTCGCCGGCGGCGTGTCGGCGCGGACTGGG
CCGCACGCGCTGCCGCTGGCTCGCATCAAGAAGATCATGAAGCGGTCGGCGGGGGACAGC
AGCGTCGTCGACGGCGGCGGCGGCGGCGGCGGCGGGGCGAGGATGATCTCCGGGGAGGCG
CCGGTGGTGTTCTCCAAGGCGTGCGAGCTGTTCATCGCCGAGCTGACGCGCCGCGCCTGG
GCCGCCACGCTCGAGGGCAAGCGCCGGACTGTGCACAAGGAGGACGTCGCCGCCGCCGTG
CAGAACACCGATCTCTTCGACTTCCTCGTCGACGTCGTCACGGCAGACCTCGGCGACGAT
CATACGGACTATAAGTAA

CDS

378 bp

>Os04t0683400-00 Similar to H0306F12.4 protein.
ATGAGGCAGGCGAGGCCCTACTCGGCGATGTTCGCCGGCGGCGTGTCGGCGCGGACTGGG
CCGCACGCGCTGCCGCTGGCTCGCATCAAGAAGATCATGAAGCGGTCGGCGGGGGACAGC
AGCGTCGTCGACGGCGGCGGCGGCGGCGGCGGCGGGGCGAGGATGATCTCCGGGGAGGCG
CCGGTGGTGTTCTCCAAGGCGTGCGAGCTGTTCATCGCCGAGCTGACGCGCCGCGCCTGG
GCCGCCACGCTCGAGGGCAAGCGCCGGACTGTGCACAAGGAGGACGTCGCCGCCGCCGTG
CAGAACACCGATCTCTTCGACTTCCTCGTCGACGTCGTCACGGCAGACCTCGGCGACGAT
CATACGGACTATAAGTAA

Protein

126 aa

>Os04t0683400-00 Similar to H0306F12.4 protein.
MRQARPYSAMFAGGVSARTGPHALPLARIKKIMKRSAGDSSVVDGGGGGGGGARMISGEA
PVVFSKACELFIAELTRRAWAATLEGKRRTVHKEDVAAAVQNTDLFDFLVDVVTADLGDD
HTDYK*

CDS

chr04:34891819..34892196 (- strand) : 378 bp

FASTA

>Os04t0683400-00 class=Sequence position=chr04:34891819..34892196 (- strand)
ATGAGGCAGG CGAGGCCCTA CTCGGCGATG TTCGCCGGCG GCGTGTCGGC GCGGACTGGG CCGCACGCGC TGCCGCTGGC
TCGCATCAAG AAGATCATGA AGCGGTCGGC GGGGGACAGC AGCGTCGTCG ACGGCGGCGG CGGCGGCGGC GGCGGGGCGA
GGATGATCTC CGGGGAGGCG CCGGTGGTGT TCTCCAAGGC GTGCGAGCTG TTCATCGCCG AGCTGACGCG CCGCGCCTGG
GCCGCCACGC TCGAGGGCAA GCGCCGGACT GTGCACAAGG AGGACGTCGC CGCCGCCGTG CAGAACACCG ATCTCTTCGA
CTTCCTCGTC GACGTCGTCA CGGCAGACCT CGGCGACGAT CATACGGACT ATAAGTAA

Locus: Os04g0683400

Loading...

Locus: Os04g0683400

Loading...