Os04t0684500-01

Locus

Os04g0684500

Description

Pentatricopeptide repeat protein, Chloroplast development under cold stress

RAP-DB Gene Symbol Synonym(s)

WSL5

RAP-DB Gene Name Synonym(s)

white stripe leaf 5

CGSNL Gene Symbol

WSL5

CGSNL Gene Name

WHITE STRIPE LEAF 5

Oryzabase Gene Symbol Synonym(s)

OsWSL5

Oryzabase Gene Name Synonym(s)

white stripe leaf 5

Transcript Evidence

AK066014

Protein Evidence

Q0J8W3

Literature

PMID: 29893948

Note

  • Exon-intron structuresare different between Build 5 and IRGSP-1.0.

Manual Curation

September 25, 2018

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Nucleotide-binding alpha-beta plait domain superfamily (IPR012677)

RNA-binding domain superfamily (IPR035979)

Tetratricopeptide-like helical domain superfamily (IPR011990)

RNA recognition motif domain (IPR000504)

Pentatricopeptide repeat (IPR002885)

Full-length cDNA

J013049M21 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0684500-01)

RiceXPro (AK066014)

Others

Oryzabase (22583)

KEGG (Os04t0684500-01)

Transcript

3417 bp

>Os04t0684500-01 Pentatricopeptide repeat protein, Chloroplast development under cold stress
GTCCGCATCCAATTCCCGGGCCATTCGAAATCCCCAACACCAGTAGCCGGCCGCGGCATG
CAGTtcctctcgctctccgccgccgccgcctcctcgccggcggccgccgtcctcccaccg
aagccattcaaacccctctcctccgcggcccccttccgtcgcccctccccgcctccgccg
cctccgtccccggtgccctcacccgcgccaccgccaccgccgcatcgcccttctccttct
cctcccccgaaccccctctcctccaAGCTATGGCTGTCCAGCAAGCTCTCCCCGCCGCCC
CCCGAGACACTAGAGCAGCCAGAGCCTTCTACTACTACTACTACTACTACCCCGCCGCCG
CCGGAACCGGAGGCGGAGGCGGAGGCGCGGCGGCAGGAGGAATTCCGGCACAAGGGGAAG
GTCTTCGTCGGGAACCTTCCACTGTGGGCCAGGAAGGCGGAGATCGCCGAGTTCTTCCGC
CAGTTTGGGCCCCTGGAGAAGGTCGAGCTCGTGCGCGGCCACGACGATCCCGAGCGCAAC
GTGGGCTTCTGCTTCCTATACTACGGAGGCGACGACGCGGACGCCGCGGCGGAGCGTGCG
GTGGAGGTTGACGGGGTTGACTTCCGTGGGAGGTCGCTCACCGTGAGGCTTGACGACGGC
AGGAAAGGGAGGGCCAGGGCTGAGCAGCGGGCGCGCTGGGTGAACGACGGCCGGAGGCGC
GAGCCACGGTCGCCGTGGCACGAGGGCAGGGACGAGGCGTGCCGTGAGTTCCGCAGGGTG
GTGGAATCACGGCCCGACAACTGGCAGGCCGTCGTCTCTGCATTCGAGAGGATACCCAAG
CCATCAAGGAGAGAATTCGGTCTGATGATTGTTTATTATGCCAAGCGAGGTGATAAGCAT
CATGCTCGTGCAACATTTGAGAACATGAGAGCAAGAGGAATAGAGCCCAATGCATTTGTT
TTTACAAGCCTTGTTCACGCTTATGCAGTTGCTAGAGATATGCGTGGAGCTCTGTCTTGC
GTTGAGGAAATGAAATCTGAGGGTCTTGAGCTGACAATTGTTACCTACAGTATCCTTATT
TCAGGATTCGCCAAAATTAATGATTCCCAATCTGCAGATAACTTGTTCAAAGAGGCTAAG
ACCAAGCTTAGCAGTCTCAATGGAATCATATATAGTAACATCATACATGCTCACTGTCAA
TCTGGCAATATGGAACGGGCTGAAGAACTGGTGCGTGAAATGGAAGAGGATGGGATAGAT
GCTCCTATAGATGTATATCACAGTATGATGCATGGATATACCATCATTCAGAACGAAAAT
AAATGTCTAGTTGTCTTTGAACGGCTTAAGGAGTGTGGCTTTAAACCATCAATAATCTCT
TATGGGTGCCTTCTTAATTTGTATGTCAAGATAGGTAAGGTTGCCAAAGCATTATCTATT
AGCAAAGAAATGGAGTCTTGTGGCATCAAACATAATAATAAAACATACTCTATGCTTATC
AATGGATTTATCCATTTGCACGACTTTGCAAATGCTTTCGCCATATTTGAGGAAATGCTA
AGATCAGGTCTACAACCTGATCGTGCCATATACAATTTGCTTATAGAGGCATTTTGTAAG
ATGGGAAACATGGATCGTGCTATTTGCATTTTGGAAAAAATGCAGAAGGAACGAATGCAA
CCATCAAATAGAGCATTCAGGCCTATCATAGAGGGATATGCAGTTGCTGGTGATATGAAA
AGTGCTTTGGATACTCTTGATCTGATGCGGCGAAGTGGTTGTGTTCCCACTGTAATGACT
TACAATGCTCTCATTCACGGGCTAGTTAGAAAGCACAAGGTTCAAAGAGCTGTCTCTGTG
CTTGATAAGATGTCCATCGCTGGCATTACACCAAATGAGCATACATACACAATCATTATG
AGAGGTTATGCTGCCAGTGGAGATATTGGGAAGGCTTTTGAATACTTCACCAAAATAAAA
GAGAGTGGTCTAAAACTCGATGTGTACATTTATGAAACATTGCTCAGAGCCTGTTGCAAA
TCAGGGAGGATGCAGAGTGCCTTAGCAGTCACTCGTGAGATGAGCTTCCAAAAGATACCA
AGGAATACATTTATATATAATATTTTGATTGATGGATGGGCTCGGAGAGGTGATGTTTGG
GAAGCAGAGGACTTGATGAAGCAGATGAAAGAAGATGGTGTCCCTCCTAACATCCATACT
TATACCTCCTATATAAATGCATGCTGCAAGGCAGGAGACATGCAGAGAGCAGAAAAGGTG
ATTGAAGAAATGGTAGATGTTGGACTAAAACCTAATGTCAAGACATATACTACCTTGATT
AAAGGTTGGGCAAGAGTGTCACTTCCAGACAGGGCATTGAAATGCTTTGAGGAGATGAAA
CTTGCTGGGTTGAAACCTGATGAGGCTTCTTATCATTGCTTGGTGACTTCACTTCTGTCA
AGGGCAACTGTAATGGAGGGAAGTACCTACACAGGAATCATTAGTGTCTGTAGAGAAATG
TCTGAGAATGATTTGACTGTTGATCTTCGCACTGCTGTTCACTGGTCTAGATGGCTTCAC
AAGATTGAGAGGACTGGAGGGGCACTAACAGAAGCGCTTCAGAGAATATTTCCTCCTGAT
TGGAATTCATTAGAATTTTTAGGAGAGCCATCCAGTTCTATAAGCATGGGGGAGTCTGAT
GATTACAGTGATTCAGATTTTAGCGGTGATGAAGATGAGGATCATAATATTGATGATAGC
TGAAAAACTCTAGATTCCAGAGCCTGTTTTTCTTGTTCTGTGCCCTCACTTTTTGTCCTT
TGGTTCTGCCAGAGTGGATGACCGAACAAGcaatgtctttgatcaaactgtgccctcaca
ttcagacaccagtggcttgtggactatccaagagcgtttggaatcttatagtgcaataag
cgtgagctggctggcctctgctgcgtttcttcaagagcaacagtcagtaacagttctact
gggactgaagacacaggctgtcaatgcaacagacgaagcttactcagttatgcgtgtagc
tgtacatATCAATGGCTGGCACAGAGAGGCCAACAGGAGCTATAAAATGATGTTCCGATT
GCTGTTAATTACCTGGAAACTGTACTGTACTGGGCGAGTGATGAAGGTAGGATGGAAGCG
CCAAGCTGCTGTGAACAACTGAGGGAAAATTCAGGTGTAATTTCCTCTCTAGTCTCTAGA
ATTACAAGGCAAGGTATATATTTTTAACGTTTTTGTTTATGAATAGAAGATGAGCTATGC
TTAGATTATGGATTGTATAGTACCCGCCCATTGAGGCTGGGCTGGGTCCTCCAGAATATA
TACCCCTGCATGTGTCACTGACATCATTTGGTCGACATGATAGAAATATTTGGGAGC

CDS

2706 bp

>Os04t0684500-01 Pentatricopeptide repeat protein, Chloroplast development under cold stress
ATGCAGTtcctctcgctctccgccgccgccgcctcctcgccggcggccgccgtcctccca
ccgaagccattcaaacccctctcctccgcggcccccttccgtcgcccctccccgcctccg
ccgcctccgtccccggtgccctcacccgcgccaccgccaccgccgcatcgcccttctcct
tctcctcccccgaaccccctctcctccaAGCTATGGCTGTCCAGCAAGCTCTCCCCGCCG
CCCCCCGAGACACTAGAGCAGCCAGAGCCTTCTACTACTACTACTACTACTACCCCGCCG
CCGCCGGAACCGGAGGCGGAGGCGGAGGCGCGGCGGCAGGAGGAATTCCGGCACAAGGGG
AAGGTCTTCGTCGGGAACCTTCCACTGTGGGCCAGGAAGGCGGAGATCGCCGAGTTCTTC
CGCCAGTTTGGGCCCCTGGAGAAGGTCGAGCTCGTGCGCGGCCACGACGATCCCGAGCGC
AACGTGGGCTTCTGCTTCCTATACTACGGAGGCGACGACGCGGACGCCGCGGCGGAGCGT
GCGGTGGAGGTTGACGGGGTTGACTTCCGTGGGAGGTCGCTCACCGTGAGGCTTGACGAC
GGCAGGAAAGGGAGGGCCAGGGCTGAGCAGCGGGCGCGCTGGGTGAACGACGGCCGGAGG
CGCGAGCCACGGTCGCCGTGGCACGAGGGCAGGGACGAGGCGTGCCGTGAGTTCCGCAGG
GTGGTGGAATCACGGCCCGACAACTGGCAGGCCGTCGTCTCTGCATTCGAGAGGATACCC
AAGCCATCAAGGAGAGAATTCGGTCTGATGATTGTTTATTATGCCAAGCGAGGTGATAAG
CATCATGCTCGTGCAACATTTGAGAACATGAGAGCAAGAGGAATAGAGCCCAATGCATTT
GTTTTTACAAGCCTTGTTCACGCTTATGCAGTTGCTAGAGATATGCGTGGAGCTCTGTCT
TGCGTTGAGGAAATGAAATCTGAGGGTCTTGAGCTGACAATTGTTACCTACAGTATCCTT
ATTTCAGGATTCGCCAAAATTAATGATTCCCAATCTGCAGATAACTTGTTCAAAGAGGCT
AAGACCAAGCTTAGCAGTCTCAATGGAATCATATATAGTAACATCATACATGCTCACTGT
CAATCTGGCAATATGGAACGGGCTGAAGAACTGGTGCGTGAAATGGAAGAGGATGGGATA
GATGCTCCTATAGATGTATATCACAGTATGATGCATGGATATACCATCATTCAGAACGAA
AATAAATGTCTAGTTGTCTTTGAACGGCTTAAGGAGTGTGGCTTTAAACCATCAATAATC
TCTTATGGGTGCCTTCTTAATTTGTATGTCAAGATAGGTAAGGTTGCCAAAGCATTATCT
ATTAGCAAAGAAATGGAGTCTTGTGGCATCAAACATAATAATAAAACATACTCTATGCTT
ATCAATGGATTTATCCATTTGCACGACTTTGCAAATGCTTTCGCCATATTTGAGGAAATG
CTAAGATCAGGTCTACAACCTGATCGTGCCATATACAATTTGCTTATAGAGGCATTTTGT
AAGATGGGAAACATGGATCGTGCTATTTGCATTTTGGAAAAAATGCAGAAGGAACGAATG
CAACCATCAAATAGAGCATTCAGGCCTATCATAGAGGGATATGCAGTTGCTGGTGATATG
AAAAGTGCTTTGGATACTCTTGATCTGATGCGGCGAAGTGGTTGTGTTCCCACTGTAATG
ACTTACAATGCTCTCATTCACGGGCTAGTTAGAAAGCACAAGGTTCAAAGAGCTGTCTCT
GTGCTTGATAAGATGTCCATCGCTGGCATTACACCAAATGAGCATACATACACAATCATT
ATGAGAGGTTATGCTGCCAGTGGAGATATTGGGAAGGCTTTTGAATACTTCACCAAAATA
AAAGAGAGTGGTCTAAAACTCGATGTGTACATTTATGAAACATTGCTCAGAGCCTGTTGC
AAATCAGGGAGGATGCAGAGTGCCTTAGCAGTCACTCGTGAGATGAGCTTCCAAAAGATA
CCAAGGAATACATTTATATATAATATTTTGATTGATGGATGGGCTCGGAGAGGTGATGTT
TGGGAAGCAGAGGACTTGATGAAGCAGATGAAAGAAGATGGTGTCCCTCCTAACATCCAT
ACTTATACCTCCTATATAAATGCATGCTGCAAGGCAGGAGACATGCAGAGAGCAGAAAAG
GTGATTGAAGAAATGGTAGATGTTGGACTAAAACCTAATGTCAAGACATATACTACCTTG
ATTAAAGGTTGGGCAAGAGTGTCACTTCCAGACAGGGCATTGAAATGCTTTGAGGAGATG
AAACTTGCTGGGTTGAAACCTGATGAGGCTTCTTATCATTGCTTGGTGACTTCACTTCTG
TCAAGGGCAACTGTAATGGAGGGAAGTACCTACACAGGAATCATTAGTGTCTGTAGAGAA
ATGTCTGAGAATGATTTGACTGTTGATCTTCGCACTGCTGTTCACTGGTCTAGATGGCTT
CACAAGATTGAGAGGACTGGAGGGGCACTAACAGAAGCGCTTCAGAGAATATTTCCTCCT
GATTGGAATTCATTAGAATTTTTAGGAGAGCCATCCAGTTCTATAAGCATGGGGGAGTCT
GATGATTACAGTGATTCAGATTTTAGCGGTGATGAAGATGAGGATCATAATATTGATGAT
AGCTGA

Protein

902 aa

>Os04t0684500-01 Pentatricopeptide repeat protein, Chloroplast development under cold stress
MQFLSLSAAAASSPAAAVLPPKPFKPLSSAAPFRRPSPPPPPPSPVPSPAPPPPPHRPSP
SPPPNPLSSKLWLSSKLSPPPPETLEQPEPSTTTTTTTPPPPEPEAEAEARRQEEFRHKG
KVFVGNLPLWARKAEIAEFFRQFGPLEKVELVRGHDDPERNVGFCFLYYGGDDADAAAER
AVEVDGVDFRGRSLTVRLDDGRKGRARAEQRARWVNDGRRREPRSPWHEGRDEACREFRR
VVESRPDNWQAVVSAFERIPKPSRREFGLMIVYYAKRGDKHHARATFENMRARGIEPNAF
VFTSLVHAYAVARDMRGALSCVEEMKSEGLELTIVTYSILISGFAKINDSQSADNLFKEA
KTKLSSLNGIIYSNIIHAHCQSGNMERAEELVREMEEDGIDAPIDVYHSMMHGYTIIQNE
NKCLVVFERLKECGFKPSIISYGCLLNLYVKIGKVAKALSISKEMESCGIKHNNKTYSML
INGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAICILEKMQKERM
QPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQRAVS
VLDKMSIAGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVYIYETLLRACC
KSGRMQSALAVTREMSFQKIPRNTFIYNILIDGWARRGDVWEAEDLMKQMKEDGVPPNIH
TYTSYINACCKAGDMQRAEKVIEEMVDVGLKPNVKTYTTLIKGWARVSLPDRALKCFEEM
KLAGLKPDEASYHCLVTSLLSRATVMEGSTYTGIISVCREMSENDLTVDLRTAVHWSRWL
HKIERTGGALTEALQRIFPPDWNSLEFLGEPSSSISMGESDDYSDSDFSGDEDEDHNIDD
S*

5'UTR

chr04:34958612..34958668 (+ strand) : 57 bp

CDS

chr04:34958669..34959451 (+ strand) : 783 bp

chr04:34960384..34960511 (+ strand) : 128 bp

chr04:34960958..34961098 (+ strand) : 141 bp

chr04:34961319..34961405 (+ strand) : 87 bp

chr04:34961490..34961643 (+ strand) : 154 bp

chr04:34963432..34963491 (+ strand) : 60 bp

chr04:34963882..34964310 (+ strand) : 429 bp

chr04:34964387..34964682 (+ strand) : 296 bp

chr04:34965141..34965270 (+ strand) : 130 bp

chr04:34965553..34966050 (+ strand) : 498 bp

3'UTR

chr04:34966051..34966137 (+ strand) : 87 bp

chr04:34966320..34966553 (+ strand) : 234 bp

chr04:34969678..34970010 (+ strand) : 333 bp

FASTA

>Os04t0684500-01 class=Sequence position=chr04:34958612..34970010 (+ strand)
GTCCGCATCC AATTCCCGGG CCATTCGAAA TCCCCAACAC CAGTAGCCGG CCGCGGCATG CAGTtcctct cgctctccgc
cgccgccgcc tcctcgccgg cggccgccgt cctcccaccg aagccattca aacccctctc ctccgcggcc cccttccgtc
gcccctcccc gcctccgccg cctccgtccc cggtgccctc acccgcgcca ccgccaccgc cgcatcgccc ttctccttct
cctcccccga accccctctc ctccaAGCTA TGGCTGTCCA GCAAGCTCTC CCCGCCGCCC CCCGAGACAC TAGAGCAGCC
AGAGCCTTCT ACTACTACTA CTACTACTAC CCCGCCGCCG CCGGAACCGG AGGCGGAGGC GGAGGCGCGG CGGCAGGAGG
AATTCCGGCA CAAGGGGAAG GTCTTCGTCG GGAACCTTCC ACTGTGGGCC AGGAAGGCGG AGATCGCCGA GTTCTTCCGC
CAGTTTGGGC CCCTGGAGAA GGTCGAGCTC GTGCGCGGCC ACGACGATCC CGAGCGCAAC GTGGGCTTCT GCTTCCTATA
CTACGGAGGC GACGACGCGG ACGCCGCGGC GGAGCGTGCG GTGGAGGTTG ACGGGGTTGA CTTCCGTGGG AGGTCGCTCA
CCGTGAGGCT TGACGACGGC AGGAAAGGGA GGGCCAGGGC TGAGCAGCGG GCGCGCTGGG TGAACGACGG CCGGAGGCGC
GAGCCACGGT CGCCGTGGCA CGAGGGCAGG GACGAGGCGT GCCGTGAGTT CCGCAGGGTG GTGGAATCAC GGCCCGACAA
CTGGCAGGCC GTCGTCTCTG CATTCGAGAG GATACCCAAG GTGTGGCTTC TCATCTCAAA ATCTATTTTC TGCTATTTCC
GGTGAATAAT AGGACATCAA TTGCATATTA TGTATTTTTT TTGAAACCAA ACCAATTGCA TTGTTATAGG TGTACACGTG
TGTGTTTTCA AGAATGCAAA GCAGGTGAAG TTTTTCTATA AGTAATTTTG CAGGAAGCAG TACCGTTCGC ATAGGAGTCC
TACAAATGTC ATCTGTATTT CGGAATAGGG ATTAATGTGC CACTGAATAG GCACATCTTT ATTATACAAT GCATGTTTGA
ATTTACATGT TAGCAAACTT GTCATGAAAA TTGTCATTTC AATGCCATCT TCAGCTGTCT GGTGTAGTTA GCGCATACTT
CCCTCTTTGT AAGCAAAGTT TTGGATGTCC TGGATCTTAC TTACCCATTT CTTTTTAAAA AACTGCTCCA TGAGGTAATA
TTCATTACAC AAATACCAGA TGCTTCATCT TTTCCTATTA GATTTGATGC TAATTCATGT AGTCAATATA TCATATAGTT
CACTAGTTCA GTATATTTGT TATTTTCttt tagataatgg atcctttatt gaactcatta aatcacatcg aggtgataca
attgtcctcc cgacctttgc attataagTT ATAACTTTTC TTGAGAATAG GTATACAATT ACTTCATTGA GATTTCTGGT
TAGTGAGTGA GCAACTATAT TTTTTCGAAT AAAATTATAA AATGTGCCAA TTCTTAATGT TCAAAAATCT CTACATTCAT
GGTTATGTGT TCACATCTTC CCAAGAAAGT TCAAGTGCCA CAGGAGAAAA AAACAGGTCT AGCTGATGCT TATTGAATTT
ATTGCATTGA AGATAGAGGC ATCTCATAAC TCATATTACC ATTAGTACAT TGTTGTATGC AATGCATTGA CACTTCTATC
TTGATGTTTC AGCCATCAAG GAGAGAATTC GGTCTGATGA TTGTTTATTA TGCCAAGCGA GGTGATAAGC ATCATGCTCG
TGCAACATTT GAGAACATGA GAGCAAGAGG AATAGAGCCC AATGCATTTG TTTTTACAAG GTAGGTTTAT TCTTTCTGCT
ATTTGCAAAC GTTTTGTTGC TGTTCTTTTC CAATCATGGA CAAACTGGTG TAGGATAAAA TGTGTAGCCA GAGGATTTGT
GTAAAAAAAA AACAACCCTG AAACAGACAG GCTACAGAAT TTTTACTACG TAAAGATAAG AACTTACATG AGATAAACAT
CACGAGGGAA CTGAAAGAAC AGTTGGTAAG GAACCTTACA CAGAATCAGA CTAATTGGTT CCTTGGATCC TGGTTTGCCA
GCTTGAGATA AGAAAATGTT CACTGATAAA ATTGTTGACA TAGAAAGCCA TGTAACTTTC ATGGTGTAAG CATATATGGT
GCAACTGTTT ATGCCTGGTA TGTTAGCTTT AGCAAAATCT TTATGATTGC TCTAATTGCT GCTTGTTGAT TTGCCTCCTG
CATTAAATTT ACTTCATTTC ATGCAGCCTT GTTCACGCTT ATGCAGTTGC TAGAGATATG CGTGGAGCTC TGTCTTGCGT
TGAGGAAATG AAATCTGAGG GTCTTGAGCT GACAATTGTT ACCTACAGTA TCCTTATTTC AGGATTCGCC AAAATTAATG
ATTCCCAGTG AGTATTTTCT GCTCATTGAC TAGAGCCTGT TCTACGTACT ACTCTCACAT GCTTTGTTCA GAATGAATGA
TAGATCTGTT ATAGCTCTTT TATGCGTAGC ATATTCTCAT TCAGTTTTAA ACATTTCTCT GTGCATTTGG CCACTTAAAC
ATTCTCTCGT CTTTCTTGGC CCAAGGACCC TGACTTTTTG CTAATATTTT TTTATCTTGT TTGAAAGATC TGCAGATAAC
TTGTTCAAAG AGGCTAAGAC CAAGCTTAGC AGTCTCAATG GAATCATATA TAGTAACATC ATACATGCTC ACTGGTTAGT
ATTTGTCAGA TTTATAAACC TCTTGGAACT TAACACTGAT ATGAGATTGA TTTAACACTA AAGTACCTGT ACTTGCAGTC
AATCTGGCAA TATGGAACGG GCTGAAGAAC TGGTGCGTGA AATGGAAGAG GATGGGATAG ATGCTCCTAT AGATGTATAT
CACAGTATGA TGCATGGATA TACCATCATT CAGAACGAAA ATAAATGTCT AGTTGTCTTT GAACGGCTTA AGGTATAGTG
GAAACTGTCT TCTCATGGGT AACCGATCTG GCTTTCTTAT ATTTCTATTA AGTCCAGTTT GGTCCTCAAT CCTTCTTGTG
GTCTAATTTT CATTTCATGG CCAGCTTCAA GACCATTTAG TTTACACAAC TAAAATGCCA AAACTGGTAC AAATAACCCC
TTGTATTCAA ATCATCGTGT TATTATCCCA TTTTACTGTG ACAAAGACAC ATTGACAACT TGAATTACCA TTGAGGTTGG
TGAGTCAGCA CTTTTTTTTT TTTGAGCAAG GGCGACTGCC CCCATTTCTA TTACCCGAAA TGGAACATAG TAGTTTACAG
AGTGCAAGGA AGAAAGACAT GAAGAAACAG CATAAGGGCT AGAAAAGACA ACAAAAGGAA GATTACAGGT TTCTCATTCA
ACAGGAATTC CACACCACCG TGCATATGAC CCTCCATCAA CCGAAGCCGA AAGCACAAAA ACAACCCCTC AACCATAGCA
AAAGCTCTTC TGACATCAGT ATGCTGGGCC AAACCAAAAG AACATCAACT TTCTTTTGTG TTCCTGAAGC CATGTAcctt
catccttcca gtcttctcgt cctagtgtac catccatact tcgagctgaa aacatcattt gctacctgcc ttattagcct
ggctcccaga agcaactttt cttgatttgc ctccaacatc tgcagcacag cccaagtttc aatccaatga caagtcaagt
aaactacatc aatgggatct tAAAACGGAT GGGACCTGCC TGCTGTCCTG TTCTGTTTTT GCTCCTTATC TCTCCCTCCA
GATCTGGTAA TCTTATATCT CCAGGATCCA AGTTTCTTTC AGATTCCGTC AGTTAGCTAT TGTAACCAGT CCCTTGGCCA
GACCTCACCT CTGGTTTTAT TTGGAGCAAA CGAAAGTACC AACTCAACTC AAAGATATTT TGGAATTCAT GGCTGGTAAT
CAAAGACCGA TTCAAGTTAA GAAATTCATT TCTGGATTTT CCAGATAGTG AGCAAAAGAA ACAATGGGGC ACGACAATTG
CAGGCCCATG GTAGGAAGCA TAGCAGAAGC TGTAGTAGGG CCAGGAGCAG TGAAGTGAGA AGCTTATCTG CCCTGATTCT
GGCAGCAGCA ACAAAGTGCC AGAAGTCCAG GAGTGGGTGA GAAAGGAGAG GTGGGAAGTG GGAATTTCTG GCCATGGTGG
TGCTGCTCAG CCAGAAACCT TAGTGGTGCT GACCAGCGAT GAAAGTATGG AACTAATGTG CTTTGTGATC ATATTATCCA
TGGAAGCTAC AAGAATGAAA CCACACCCTT TCCTCTCATT AATTTCTGTA TGTTCCTTTT AAATATGCAT ATGCATTGAT
GTTTAGGTGT ATGAGTATTT TTTTGGGAAA ATGACCTATC TGCATATCAC TGCATTGCAT ATCTGTACAG TATCGGAGTA
TCTGGGAAAC ACAGATGATG AAGTTACTTG ATCTGTGGAT ACAACTTTGT ATCATCGAGG ATGGTGTCAA GGAAATGAGG
AAGAGAAAAA ATAAGCATAT CGCTGTTATC GGGCCACACC ACCCTGTGGA CTAAAATGGA GGCGGTTTTA GCTCAGGGAT
GTAATTTGCA CCTGTTTTGA TATTTGGAAG ACCTGTGATA AATGGTTCTA AAGTTTAAGG GTGAAATACT GAAACGTAAA
ATTAGACTAC AAGAGGAGTT GAGGGACCAG AGATAGATGT ATTCATAATT TTTATTTTTT CTATCTCCCC TTCTGATCTG
ATTTTTCCTG TTTTTTGCAG GAGTGTGGCT TTAAACCATC AATAATCTCT TATGGGTGCC TTCTTAATTT GTATGTCAAG
GTAAAAGTAA TTCTGTTGCG TGCTTTCTTG TCAGTTTTCC TGTAATTTTG TGTGTTCCCT TAGTAGAAGG AAACAAAAAA
TTGTGCATCC CAGACAAGTG TTTTTTTCCC TCGTAAATTA TGATGTTTAA ACACTCCTTT CTGCACCATT GATTTCTATT
CGTTATATGA CTAGTATTCT GAATATCTAA GAGTCCTTGG ATTCACCTTT TTCTGAAAGC CTAAGGCAAG GGAAGCTTTA
TGTCGAGTTT CTTATACATT GAACATGACA ATCTTCAACT TTGAAACTCA AACCTGCCCC TTTATTATTA ATTGTAAGAT
AGGTTACTTG AGACAACTCT TAACAGTGAT CACTGATGTT GCTCTGGTTT CTTTTCTTTT CTCTTTTCAG ATAGGTAAGG
TTGCCAAAGC ATTATCTATT AGCAAAGAAA TGGAGTCTTG TGGCATCAAA CATAATAATA AAACATACTC TATGCTTATC
AATGGATTTA TCCATTTGCA CGACTTTGCA AATGCTTTCG CCATATTTGA GGAAATGCTA AGATCAGGTC TACAACCTGA
TCGTGCCATA TACAATTTGC TTATAGAGGC ATTTTGTAAG ATGGGAAACA TGGATCGTGC TATTTGCATT TTGGAAAAAA
TGCAGAAGGA ACGAATGCAA CCATCAAATA GAGCATTCAG GCCTATCATA GAGGGATATG CAGTTGCTGG TGATATGAAA
AGTGCTTTGG ATACTCTTGA TCTGATGCGG CGAAGTGGTT GTGTTCCCAC TGTAATGACT TACAATGCTC TCATTCACGG
GCTAGTTAGA AAGCACAAGG TATTTTTCAA GTACATGCTA GTTTCTTCAA ATCTAATCCT GTCATGTGGC ATTTACTTTA
AATTTGTGTT TATAGGTTCA AAGAGCTGTC TCTGTGCTTG ATAAGATGTC CATCGCTGGC ATTACACCAA ATGAGCATAC
ATACACAATC ATTATGAGAG GTTATGCTGC CAGTGGAGAT ATTGGGAAGG CTTTTGAATA CTTCACCAAA ATAAAAGAGA
GTGGTCTAAA ACTCGATGTG TACATTTATG AAACATTGCT CAGAGCCTGT TGCAAATCAG GGAGGATGCA GAGTGCCTTA
GCAGTCACTC GTGAGATGAG CTTCCAAAAG ATACCAAGGA ATACATTTAT ATATAATATT TTGATTGATG GGTAGGTGTT
CTAGATAAGC TCTTTAGCCA ATGTTTTTAC TGACTAGTAA CGATCTTTTT ACCGACTCAG TACTCAGGGA CGCTTGTGAC
CATTTATTTA TGTGTTGACT GCATCGAACT ACTTAGTCAA CTGCTGTACT GACTCAGGGA TACAAGAAAG TATTATGGAA
AAAAATAATA TAGGGGGTAG AGAACAACCC CTCAATATTT TTAGTAGAAG GTTGTGGTTG AACCTGTGGA GGGCTAGCAC
AGCGAACTGT GCTGTTAGCC AGTAGGTCCT AATAGTCTCC TCACATGAAA CTATTATGAT ATTTCATTGG ATTAGTCATA
CATTAGTTTT GAAAATTTGT ATTATATACT GAGTTCATGT TTTATTTGAG TCTTGCTGTA ATTTATGAAG TTTTATAAAA
GCGGTATATT TTCCTTTTTG CCTGTTTCGT CACAAATCCT TTTGTGTAGA TGGGCTCGGA GAGGTGATGT TTGGGAAGCA
GAGGACTTGA TGAAGCAGAT GAAAGAAGAT GGTGTCCCTC CTAACATCCA TACTTATACC TCCTATATAA ATGCATGCTG
CAAGGCAGGA GACATGCAGG TACGAGAATT TTGCATTGGA ATACTTAGTT TCTTACTTAT TGTGAGTTGT AACCGTGTAG
TGGAGATAGC CTGATTTTGA TAGGATATGT GCACATGTTT TAAGGTAGCT GACCAAAATA TTTTACAATG CCATGACTAT
ATGCCCGAAT TATTTCAGCA CTACAGATTT ACCTAGGTGG CTACATATTC AAATTTGGCA CTTGTGAATG GAGAAGTATT
CTCTTGGGGC CTTCTTGTAA TCTATCCAAT TATTTTTTTT TATAAAATGA TTTGTTTGTA GAGAGCAGAA AAGGTGATTG
AAGAAATGGT AGATGTTGGA CTAAAACCTA ATGTCAAGAC ATATACTACC TTGATTAAAG GTTGGGCAAG AGTGTCACTT
CCAGACAGGG CATTGAAATG CTTTGAGGAG ATGAAACTTG CTGGGTTGAA ACCTGATGAG GCTTCTTATC ATTGCTTGGT
GACTTCACTT CTGTCAAGGG CAACTGTAAT GGAGGGAAGT ACCTACACAG GAATCATTAG TGTCTGTAGA GAAATGTCTG
AGAATGATTT GACTGTTGAT CTTCGCACTG CTGTTCACTG GTCTAGATGG CTTCACAAGA TTGAGAGGAC TGGAGGGGCA
CTAACAGAAG CGCTTCAGAG AATATTTCCT CCTGATTGGA ATTCATTAGA ATTTTTAGGA GAGCCATCCA GTTCTATAAG
CATGGGGGAG TCTGATGATT ACAGTGATTC AGATTTTAGC GGTGATGAAG ATGAGGATCA TAATATTGAT GATAGCTGAA
AAACTCTAGA TTCCAGAGCC TGTTTTTCTT GTTCTGTGCC CTCACTTTTT GTCCTTTGGT TCTGCCAGAG TGGATGACCG
AACAAGGTAT TATGTGTTGA ACTGTTAATA TGTGTTTAAT ATGCCATTTC CTTTTGGTGA TGTTTCTAAA AAGCACACAT
AATAATTCTT GAAAAGGAGT CTGCCAACAA TCATTTGTCA TTACTCAttg ccactttttg gagttcctgg aaattgcatt
gaactaacac tctttgtttc catggcagca atgtctttga tcaaactgtg ccctcacatt cagacaccag tggcttgtgg
actatccaag agcgtttgga atcttatagt gcaataagcg tgagctggct ggcctctgct gcgtttcttc aagagcaaca
gtcagtaaca gttctactgg gactgaagac acaggctgtc aatgcaacag acgaagctta ctcagttatg cgtgtagctg
tacatATCAA TGGCTGGCAC AGGTAAATAT TCTTGAGATA TTGACAGATT CAATTGTTGT TTCTCTCCAT CCTTTCAGTA
TAGTCCAACT TGATATAAAA TCCAATTCCA TATATATGTG TATAAATGCA AGTAAAGCTA TACCACGTTA CCAGTTACCA
CCCACACCCC TTCTTGGCTT GCCTTTTGTA GTGTGCCATG TGAAATGTAC CGACCATGAT AGAGCCTGCG TGCCCATTTT
TCAACATCCA AATGTTAGGA GTGGTAGGAG CGCTTATAGG CATATGCTTG AACACCACTT TGATTGGCAG AATTTTGTAG
GGGCAGCACA GTGTGCCTAC AAGGTTTGGT TTTGTAACCA CATCCCTGGA CAAGCCGTTC GATGCTTATT TGAATACTAG
TACGACAAAC CAATCTGTGT CGTGGTGCTC GTAAAAGCTG AGATCATTTA AACTTGTAAG TAGAAAGTTG GACGAGCTTT
TTTCTCTTCG AGAGAATGCA CAGGCCCTCA TGTTCTTTGT TTTGATGATC TTAAAAAAAC CATAGTCAAG GTAAATAGGA
GCAAAGATTG GTATCTTGCA CATTATTGCG GGTTGGGCTT ATTCAATGGG GGAATTCCCT ATTGAAACTG AAGTACAAGT
CCAATCAAGT GCTAGATGAT GACTGTTTTC TCATTTAAGG TTTGGCATCT TCCAGTACAG CAGCTTCAAT CAAATGGGCC
TTAACGTAGC TCAGCCCGAT TCAATATTAC TTGGAATTGC ACGCCTCTGT CCAAGCTGAA AGCTTTTACT AGTAGGACAC
TTGAATGCCT GCACAAGACG GCATTAATGC TGTGCTTATG AGCCCGATTT CTTGAGACTG GTGTTGAGTT TGTGCGTATG
TGTGTGCTAT GAGCTGCGAA TCTTAGCTGG CCGGTATCTT TCATTGAATC GAAAGTGGCC TCCCCATTCA AGTCTTGCCC
ACAAGATAAA ACAGTGCTTC ATTTATGCCT GTTATTTAAT TTTGCTTAGC TGCATCTCGC TTCTCCATTC ATACACCATA
AATTCTTTCA AAGAAATCTT GATTGTATTA GTGTTGTATT AGGCCTTTGT TCGGAGAGAA AATTTCATAG TACCAATtac
cccctccatc ccaaaatata ataacttcta tcactaagag tttgttccaa aataaaataa cttatccacc aacattctct
tcctaactaa tcataaccct gcaccattta atttttccat ctacctccac ttctcaacca atcacaatat catcatattt
aattctatct actttcttaa taattgtgtt taatcctaaa atttcttatg ttctgggacg gagatagtaG CATGTATGAA
CAGTATGAAG TACTACAATG TAAATATTTT GCCTGAAACA TGCTTTGTTT TTTTTCATGC CAAATAATTC AGTGTGATAT
TTGGTAATTC ATACAGTATT CCTTCCTTTT ATACCCACTC TAGTTTCAAA TACTTGTCAC TAGTTACTAC TTACTACTAG
CTTTTTTCCC TAAAAAAGTT ACTAGCTTTT TAGCTTTGAT CACTCGCCCT TTTTGCAAAA ATGAAACATA TGTATACTTA
AAATATGTTG CATTAGCGAT GTGTGTTCCA TAAATACAAC CAGACAACTT TCACTAATAA TAACTTAATC TTTAAAAGTT
ATTAATGGTT AAAGGTGAAA CATTATGGTT AACATTGACA AGTAAATAAA GATGGAAGGA ATACATATTT TCTAAAGATA
GGTACGGTCC TACAGGCTTT GTCCAGCAAA AAAAAAAGGA CAGTTCTGCA GAACAAAAAT ATTTTGGTGG AGTTTTTAAA
CATTGCATCC AACAGAAGCC TTATGGTATA TTTTTTTTCT ATGATAAGAG AATTTATTCT GGTTTTTTAC TTAAAAGAAG
CTGCAACCAA TTATTATAGA ATTTGCAGAA TGAATAGCTG CGGATTACAA AATTATGAAA CACAAAGTAG AAAACTACTA
AGAATACCAC CCTTAAAACA AAGATCTACA TCTATGGTTA GTCAGAGggg agtagattct aatccctcga ggggatatcc
cttcgtatat ctttttcttc caaattcgat gcaaatagtt gtgaaaaatt ctgaaaaaaa ttgacaacgt agagtataat
gatacctact agtccaccaa aattcatgtt caaattcgat ctacacatcg agaaacaaaa aagacaaatt tagatataaa
cagtacgtta ctattcatac gctgaatttg tcttttttat atctcgacgt gggagttgag tttggactta agattttgtg
aagttgtata tatgtgttgt atgaatgttg tcaaattttt ccagaatttt tcataaccgt ttagatggtt tttgagcaaa
cgagcgaaca tcccctcgag ggattagaat agtttcccTT AGTCAGAGTA TGTTTAACGT TGTTTGCTCC AATGGTTATA
AGTTGTACAG TCTCTGAAAC CAGCAGCCGA TCTTTGTCGA TCGAATTTCG ATCCCATCAC TGCCGATGAA CTGACATTGA
ACCAAAACGG AAGAAGCCTT ATGGTATGGG TGGAGAATGA AAATAGGAAA GAGACAGGAA ACATCTTTAT TCCTAAACTA
Gtactccctc cgtcccataa tataagggat tttagaggta tgtgatgttt cctcggacta cgaatctaga tcacatccct
ctaaaatccc ttatattatg ggatggagag agtaACAATT AATAGGAAAT GACACAACAG GATAGCAGAA ACTGAAAACT
TCCTTTCATT TTCTGGGGAA AAAAGGGGAA ATTTGACGTT TGGAGCTCAT CTGTAGTGGA GATTTAACTG TTCCAAAAGT
TTAGAATAGT GGCAGCTATG TTGATACAGC ACTATGTTAT CTTTTCTCAG CAGACGTGCT GGTAAAAAAA ATTTAGTGCG
AAGGGACCAT TGCTAGTTGG CCCTTACTTT TATATTACTG TAACTGATCC AGAATTAAAT TTCTACCTAT TTTCTTTGAA
AGAGCACGAA AGCACATATC AATAATTTTG GTAATATTAT TCATTTATCA TAATCTATTT TGCTATACGC TCCGACCACT
GCACAATGAC AGTATTTATT TCGCAGAGAG GCCAACAGGA GCTATAAAAT GATGTTCCGA TTGCTGTTAA TTACCTGGAA
ACTGTACTGT ACTGGGCGAG TGATGAAGGT AGGATGGAAG CGCCAAGCTG CTGTGAACAA CTGAGGGAAA ATTCAGGTGT
AATTTCCTCT CTAGTCTCTA GAATTACAAG GCAAGGTATA TATTTTTAAC GTTTTTGTTT ATGAATAGAA GATGAGCTAT
GCTTAGATTA TGGATTGTAT AGTACCCGCC CATTGAGGCT GGGCTGGGTC CTCCAGAATA TATACCCCTG CATGTGTCAC
TGACATCATT TGGTCGACAT GATAGAAATA TTTGGGAGC