Os04t0684500-02

Locus

Os04g0684500

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WSL5

CGSNL Gene Name

WHITE STRIPE LEAF 5

Oryzabase Gene Symbol Synonym(s)

OsWSL5

Oryzabase Gene Name Synonym(s)

white stripe leaf 5

Transcript Evidence

AK289251 (DDBJ, Best hit)

Protein Evidence

NP_001054310.1 (RefSeq)

Literature

Note

  • Exon-intron structuresare different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: binding (GO:0005488)

Functional domain (InterPro)

RNA recognition motif domain (IPR000504)

Pentatricopeptide repeat (IPR002885)

Tetratricopeptide-like helical (IPR011990)

Nucleotide-binding, alpha-beta plait (IPR012677)

Full-length cDNA

J100081E23 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0684500-02)

Others

Oryzabase (22583)

KEGG (Os04t0684500-02)

Transcript

3848 bp

>Os04t0684500-02 Hypothetical conserved gene.
GGGCCATTCGAAATCCCCAACACCAGTAGCCGGCCGCGGCATGCAGTtcctctcgctctc
cgccgccgccgcctcctcgccggcggccgccgtcctcccaccgaagccattcaaacccct
ctcctccgcggcccccttccgtcgcccctccccgcctccgccgcctccgtccccggtgcc
ctcacccgcgccaccgccaccgccgcatcgcccttctccttctcctcccccgaaccccct
ctcctccaAGCTATGGCTGTCCAGCAAGCTCTCCCCGCCGCCCCCCGAGACACTAGAGCA
GCCAGAGCCTTCTACTACTACTACTACTACTACCCCGCCGCCGCCGGAACCGGAGGCGGA
GGCGGAGGCGCGGCGGCAGGAGGAATTCCGGCACAAGGGGAAGGTCTTCGTCGGGAACCT
TCCACTGTGGGCCAGGAAGGCGGAGATCGCCGAGTTCTTCCGCCAGTTTGGGCCCCTGGA
GAAGGTCGAGCTCGTGCGCGGCCACGACGATCCCGAGCGCAACGTGGGCTTCTGCTTCCT
ATACTACGGAGGCGACGACGCGGACGCCGCGGCGGAGCGTGCGGTGGAGGTTGACGGGGT
TGACTTCCGTGGGAGGTCGCTCACCGTGAGGCTTGACGACGGCAGGAAAGGGAGGGCCAG
GGCTGAGCAGCGGGCGCGCTGGGTGAACGACGGCCGGAGGCGCGAGCCACGGTCGCCGTG
GCACGAGGGCAGGGACGAGGCGTGCCGTGAGTTCCGCAGGGTGGTGGAATCACGGCCCGA
CAACTGGCAGGCCGTCGTCTCTGCATTCGAGAGGATACCCAAGCCATCAAGGAGAGAATT
CGGTCTGATGATTGTTTATTATGCCAAGCGAGGTGATAAGCATCATGCTCGTGCAACATT
TGAGAACATGAGAGCAAGAGGAATAGAGCCCAATGCATTTGTTTTTACAAGCCTTGTTCA
CGCTTATGCAGTTGCTAGAGATATGCGTGGAGCTCTGTCTTGCGTTGAGGAAATGAAATC
TGAGGGTCTTGAGCTGACAATTGTTACCTACAGTATCCTTATTTCAGGATTCGCCAAAAT
TAATGATTCCCAATCTGCAGATAACTTGTTCAAAGAGGCTAAGACCAAGCTTAGCAGTCT
CAATGGAATCATATATAGTAACATCATACATGCTCACTGTCAATCTGGCAATATGGAACG
GGCTGAAGAACTGGTGCGTGAAATGGAAGAGGATGGGATAGATGCTCCTATAGATGTATA
TCACAGTATGATGCATGGATATACCATCATTCAGAACGAAAATAAATGTCTAGTTGTCTT
TGAACGGCTTAAGGAGTGTGGCTTTAAACCATCAATAATCTCTTATGGGTGCCTTCTTAA
TTTGTATGTCAAGATAGGTAAGGTTGCCAAAGCATTATCTATTAGCAAAGAAATGGAGTC
TTGTGGCATCAAACATAATAATAAAACATACTCTATGCTTATCAATGGATTTATCCATTT
GCACGACTTTGCAAATGCTTTCGCCATATTTGAGGAAATGCTAAGATCAGGTCTACAACC
TGATCGTGCCATATACAATTTGCTTATAGAGGCATTTTGTAAGATGGGAAACATGGATCG
TGCTATTTGCATTTTGGAAAAAATGCAGAAGGAACGAATGCAACCATCAAATAGAGCATT
CAGGCCTATCATAGAGGGATATGCAGTTGCTGGTGATATGAAAAGTGCTTTGGATACTCT
TGATCTGATGCGGCGAAGTGGTTGTGTTCCCACTGTAATGACTTACAATGCTCTCATTCA
CGGGCTAGTTAGAAAGCACAAGGTATTTTTCAAGTACATGCTAGTTTCTTCAAATCTAAT
CCTGTCATGTGGCATTTACTTTAAATTTGTGTTTATAGGTTCAAAGAGCTGTCTCTGTGC
TTGATAAGATGTCCATCGCTGGCATTACACCAAATGAGCATACATACACAATCATTATGA
GAGGTTATGCTGCCAGTGGAGATATTGGGAAGGCTTTTGAATACTTCACCAAAATAAAAG
AGAGTGGTCTAAAACTCGATGTGTACATTTATGAAACATTGCTCAGAGCCTGTTGCAAAT
CAGGGAGGATGCAGAGTGCCTTAGCAGTCACTCGTGAGATGAGCTTCCAAAAGATACCAA
GGAATACATTTATATATAATATTTTGATTGATGGATGGGCTCGGAGAGGTGATGTTTGGG
AAGCAGAGGACTTGATGAAGCAGATGAAAGAAGATGGTGTCCCTCCTAACATCCATACTT
ATACCTCCTATATAAATGCATGCTGCAAGGCAGGAGACATGCAGAGAGCAGAAAAGGTGA
TTGAAGAAATGGTAGATGTTGGACTAAAACCTAATGTCAAGACATATACTACCTTGATTA
AAGGTTGGGCAAGAGTGTCACTTCCAGACAGGGCATTGAAATGCTTTGAGGAGATGAAAC
TTGCTGGGTTGAAACCTGATGAGGCTTCTTATCATTGCTTGGTGACTTCACTTCTGTCAA
GGGCAACTGTAATGGAGGGAAGTACCTACACAGGAATCATTAGTGTCTGTAGAGAAATGT
CTGAGAATGATTTGACTGTTGATCTTCGCACTGCTGTTCACTGGTCTAGATGGCTTCACA
AGATTGAGAGGACTGGAGGGGCACTAACAGAAGCGCTTCAGAGAATATTTCCTCCTGATT
GGAATTCATTAGAATTTTTAGGAGAGCCATCCAGTTCTATAAGCATGGGGGAGTCTGATG
ATTACAGTGATTCAGATTTTAGCGGTGATGAAGATGAGGATCATAATATTGATGATAGCT
GAAAAACTCTAGATTCCAGAGCCTGTTTTTCTTGTTCTGTGCCCTCACTTTTTGTCCTTT
GGTTCTGCCAGAGTGGATGACCGAACAAGcaatgtctttgatcaaactgtgccctcacat
tcagacaccagtggcttgtggactatccaagagcgtttggaatcttatagtgcaataagc
gtgagctggctggcctctgctgcgtttcttcaagagcaacagtcagtaacagttctactg
ggactgaagacacaggctgtcaatgcaacagacgaagcttactcagttatgcgtgtagct
gtacatATCAATGGCTGGCACAGAGAGGCCAACAGGAGCTATAAAATGATGTTCCGATTG
CTGTTAATTACCTGGAAACTGTACTGTACTGGGCGAGTGATGAAGGTAGGATGGAAGCGC
CAAGCTGCTGTGAACAACTGAGGGAAAATTCAGaggcagccggcggcggcgggatggagg
ccgggcgcaggctagcggcggcgggatggaggtcgggcatgggctggcggcgggcggccg
gtggcggcgggatgaaggccgggcgcgggctagggctggcggcgggatggcggccgagcg
cgggttgaggctggcggctgtgccggcctggctggtttgccgtgcctgagctgcggtgct
ggtgtgcttggcggcgtgctggccggcggcgacgggatgtgctggccgggctgctgggct
gggtgcttggcggtgtgtccggcgctgggtcggcgtggattgaggccgttctgccgtgct
gtgccctcgccccccccccccctcccctagatccggccggatctggagcggcgggatggg
tggccggccggcggcgggatgggaggccgcccggtgagtcttttttttgattttttttat
ttgtggtttggatgtttttatctgtgattgaatgtatgaatctgtgatgtggtgactgag
tatgtgactcgatgttgtcaatgaacctatgaatcaatattgtgaatatatttgtgatgt
tgtgaacg

CDS

1884 bp

>Os04t0684500-02 Hypothetical conserved gene.
ATGCAGTtcctctcgctctccgccgccgccgcctcctcgccggcggccgccgtcctccca
ccgaagccattcaaacccctctcctccgcggcccccttccgtcgcccctccccgcctccg
ccgcctccgtccccggtgccctcacccgcgccaccgccaccgccgcatcgcccttctcct
tctcctcccccgaaccccctctcctccaAGCTATGGCTGTCCAGCAAGCTCTCCCCGCCG
CCCCCCGAGACACTAGAGCAGCCAGAGCCTTCTACTACTACTACTACTACTACCCCGCCG
CCGCCGGAACCGGAGGCGGAGGCGGAGGCGCGGCGGCAGGAGGAATTCCGGCACAAGGGG
AAGGTCTTCGTCGGGAACCTTCCACTGTGGGCCAGGAAGGCGGAGATCGCCGAGTTCTTC
CGCCAGTTTGGGCCCCTGGAGAAGGTCGAGCTCGTGCGCGGCCACGACGATCCCGAGCGC
AACGTGGGCTTCTGCTTCCTATACTACGGAGGCGACGACGCGGACGCCGCGGCGGAGCGT
GCGGTGGAGGTTGACGGGGTTGACTTCCGTGGGAGGTCGCTCACCGTGAGGCTTGACGAC
GGCAGGAAAGGGAGGGCCAGGGCTGAGCAGCGGGCGCGCTGGGTGAACGACGGCCGGAGG
CGCGAGCCACGGTCGCCGTGGCACGAGGGCAGGGACGAGGCGTGCCGTGAGTTCCGCAGG
GTGGTGGAATCACGGCCCGACAACTGGCAGGCCGTCGTCTCTGCATTCGAGAGGATACCC
AAGCCATCAAGGAGAGAATTCGGTCTGATGATTGTTTATTATGCCAAGCGAGGTGATAAG
CATCATGCTCGTGCAACATTTGAGAACATGAGAGCAAGAGGAATAGAGCCCAATGCATTT
GTTTTTACAAGCCTTGTTCACGCTTATGCAGTTGCTAGAGATATGCGTGGAGCTCTGTCT
TGCGTTGAGGAAATGAAATCTGAGGGTCTTGAGCTGACAATTGTTACCTACAGTATCCTT
ATTTCAGGATTCGCCAAAATTAATGATTCCCAATCTGCAGATAACTTGTTCAAAGAGGCT
AAGACCAAGCTTAGCAGTCTCAATGGAATCATATATAGTAACATCATACATGCTCACTGT
CAATCTGGCAATATGGAACGGGCTGAAGAACTGGTGCGTGAAATGGAAGAGGATGGGATA
GATGCTCCTATAGATGTATATCACAGTATGATGCATGGATATACCATCATTCAGAACGAA
AATAAATGTCTAGTTGTCTTTGAACGGCTTAAGGAGTGTGGCTTTAAACCATCAATAATC
TCTTATGGGTGCCTTCTTAATTTGTATGTCAAGATAGGTAAGGTTGCCAAAGCATTATCT
ATTAGCAAAGAAATGGAGTCTTGTGGCATCAAACATAATAATAAAACATACTCTATGCTT
ATCAATGGATTTATCCATTTGCACGACTTTGCAAATGCTTTCGCCATATTTGAGGAAATG
CTAAGATCAGGTCTACAACCTGATCGTGCCATATACAATTTGCTTATAGAGGCATTTTGT
AAGATGGGAAACATGGATCGTGCTATTTGCATTTTGGAAAAAATGCAGAAGGAACGAATG
CAACCATCAAATAGAGCATTCAGGCCTATCATAGAGGGATATGCAGTTGCTGGTGATATG
AAAAGTGCTTTGGATACTCTTGATCTGATGCGGCGAAGTGGTTGTGTTCCCACTGTAATG
ACTTACAATGCTCTCATTCACGGGCTAGTTAGAAAGCACAAGGTATTTTTCAAGTACATG
CTAGTTTCTTCAAATCTAATCCTGTCATGTGGCATTTACTTTAAATTTGTGTTTATAGGT
TCAAAGAGCTGTCTCTGTGCTTGA

Protein

628 aa

>Os04t0684500-02 Hypothetical conserved gene.
MQFLSLSAAAASSPAAAVLPPKPFKPLSSAAPFRRPSPPPPPPSPVPSPAPPPPPHRPSP
SPPPNPLSSKLWLSSKLSPPPPETLEQPEPSTTTTTTTPPPPEPEAEAEARRQEEFRHKG
KVFVGNLPLWARKAEIAEFFRQFGPLEKVELVRGHDDPERNVGFCFLYYGGDDADAAAER
AVEVDGVDFRGRSLTVRLDDGRKGRARAEQRARWVNDGRRREPRSPWHEGRDEACREFRR
VVESRPDNWQAVVSAFERIPKPSRREFGLMIVYYAKRGDKHHARATFENMRARGIEPNAF
VFTSLVHAYAVARDMRGALSCVEEMKSEGLELTIVTYSILISGFAKINDSQSADNLFKEA
KTKLSSLNGIIYSNIIHAHCQSGNMERAEELVREMEEDGIDAPIDVYHSMMHGYTIIQNE
NKCLVVFERLKECGFKPSIISYGCLLNLYVKIGKVAKALSISKEMESCGIKHNNKTYSML
INGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAICILEKMQKERM
QPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVFFKYM
LVSSNLILSCGIYFKFVFIGSKSCLCA*

5'UTR

chr04:34958629..34958668 (+ strand) : 40 bp

CDS

chr04:34958669..34959451 (+ strand) : 783 bp

chr04:34960384..34960511 (+ strand) : 128 bp

chr04:34960958..34961098 (+ strand) : 141 bp

chr04:34961319..34961405 (+ strand) : 87 bp

chr04:34961490..34961643 (+ strand) : 154 bp

chr04:34963432..34963491 (+ strand) : 60 bp

chr04:34963882..34964412 (+ strand) : 531 bp

3'UTR

chr04:34964413..34964682 (+ strand) : 270 bp

chr04:34965141..34965270 (+ strand) : 130 bp

chr04:34965553..34966137 (+ strand) : 585 bp

chr04:34966320..34966553 (+ strand) : 234 bp

chr04:34969678..34969807 (+ strand) : 130 bp

chr04:34970805..34971379 (+ strand) : 575 bp

FASTA

>Os04t0684500-02 class=Sequence position=chr04:34958629..34971379 (+ strand)
GGGCCATTCG AAATCCCCAA CACCAGTAGC CGGCCGCGGC ATGCAGTtcc tctcgctctc cgccgccgcc gcctcctcgc
cggcggccgc cgtcctccca ccgaagccat tcaaacccct ctcctccgcg gcccccttcc gtcgcccctc cccgcctccg
ccgcctccgt ccccggtgcc ctcacccgcg ccaccgccac cgccgcatcg cccttctcct tctcctcccc cgaaccccct
ctcctccaAG CTATGGCTGT CCAGCAAGCT CTCCCCGCCG CCCCCCGAGA CACTAGAGCA GCCAGAGCCT TCTACTACTA
CTACTACTAC TACCCCGCCG CCGCCGGAAC CGGAGGCGGA GGCGGAGGCG CGGCGGCAGG AGGAATTCCG GCACAAGGGG
AAGGTCTTCG TCGGGAACCT TCCACTGTGG GCCAGGAAGG CGGAGATCGC CGAGTTCTTC CGCCAGTTTG GGCCCCTGGA
GAAGGTCGAG CTCGTGCGCG GCCACGACGA TCCCGAGCGC AACGTGGGCT TCTGCTTCCT ATACTACGGA GGCGACGACG
CGGACGCCGC GGCGGAGCGT GCGGTGGAGG TTGACGGGGT TGACTTCCGT GGGAGGTCGC TCACCGTGAG GCTTGACGAC
GGCAGGAAAG GGAGGGCCAG GGCTGAGCAG CGGGCGCGCT GGGTGAACGA CGGCCGGAGG CGCGAGCCAC GGTCGCCGTG
GCACGAGGGC AGGGACGAGG CGTGCCGTGA GTTCCGCAGG GTGGTGGAAT CACGGCCCGA CAACTGGCAG GCCGTCGTCT
CTGCATTCGA GAGGATACCC AAGGTGTGGC TTCTCATCTC AAAATCTATT TTCTGCTATT TCCGGTGAAT AATAGGACAT
CAATTGCATA TTATGTATTT TTTTTGAAAC CAAACCAATT GCATTGTTAT AGGTGTACAC GTGTGTGTTT TCAAGAATGC
AAAGCAGGTG AAGTTTTTCT ATAAGTAATT TTGCAGGAAG CAGTACCGTT CGCATAGGAG TCCTACAAAT GTCATCTGTA
TTTCGGAATA GGGATTAATG TGCCACTGAA TAGGCACATC TTTATTATAC AATGCATGTT TGAATTTACA TGTTAGCAAA
CTTGTCATGA AAATTGTCAT TTCAATGCCA TCTTCAGCTG TCTGGTGTAG TTAGCGCATA CTTCCCTCTT TGTAAGCAAA
GTTTTGGATG TCCTGGATCT TACTTACCCA TTTCTTTTTA AAAAACTGCT CCATGAGGTA ATATTCATTA CACAAATACC
AGATGCTTCA TCTTTTCCTA TTAGATTTGA TGCTAATTCA TGTAGTCAAT ATATCATATA GTTCACTAGT TCAGTATATT
TGTTATTTTC ttttagataa tggatccttt attgaactca ttaaatcaca tcgaggtgat acaattgtcc tcccgacctt
tgcattataa gTTATAACTT TTCTTGAGAA TAGGTATACA ATTACTTCAT TGAGATTTCT GGTTAGTGAG TGAGCAACTA
TATTTTTTCG AATAAAATTA TAAAATGTGC CAATTCTTAA TGTTCAAAAA TCTCTACATT CATGGTTATG TGTTCACATC
TTCCCAAGAA AGTTCAAGTG CCACAGGAGA AAAAAACAGG TCTAGCTGAT GCTTATTGAA TTTATTGCAT TGAAGATAGA
GGCATCTCAT AACTCATATT ACCATTAGTA CATTGTTGTA TGCAATGCAT TGACACTTCT ATCTTGATGT TTCAGCCATC
AAGGAGAGAA TTCGGTCTGA TGATTGTTTA TTATGCCAAG CGAGGTGATA AGCATCATGC TCGTGCAACA TTTGAGAACA
TGAGAGCAAG AGGAATAGAG CCCAATGCAT TTGTTTTTAC AAGGTAGGTT TATTCTTTCT GCTATTTGCA AACGTTTTGT
TGCTGTTCTT TTCCAATCAT GGACAAACTG GTGTAGGATA AAATGTGTAG CCAGAGGATT TGTGTAAAAA AAAAACAACC
CTGAAACAGA CAGGCTACAG AATTTTTACT ACGTAAAGAT AAGAACTTAC ATGAGATAAA CATCACGAGG GAACTGAAAG
AACAGTTGGT AAGGAACCTT ACACAGAATC AGACTAATTG GTTCCTTGGA TCCTGGTTTG CCAGCTTGAG ATAAGAAAAT
GTTCACTGAT AAAATTGTTG ACATAGAAAG CCATGTAACT TTCATGGTGT AAGCATATAT GGTGCAACTG TTTATGCCTG
GTATGTTAGC TTTAGCAAAA TCTTTATGAT TGCTCTAATT GCTGCTTGTT GATTTGCCTC CTGCATTAAA TTTACTTCAT
TTCATGCAGC CTTGTTCACG CTTATGCAGT TGCTAGAGAT ATGCGTGGAG CTCTGTCTTG CGTTGAGGAA ATGAAATCTG
AGGGTCTTGA GCTGACAATT GTTACCTACA GTATCCTTAT TTCAGGATTC GCCAAAATTA ATGATTCCCA GTGAGTATTT
TCTGCTCATT GACTAGAGCC TGTTCTACGT ACTACTCTCA CATGCTTTGT TCAGAATGAA TGATAGATCT GTTATAGCTC
TTTTATGCGT AGCATATTCT CATTCAGTTT TAAACATTTC TCTGTGCATT TGGCCACTTA AACATTCTCT CGTCTTTCTT
GGCCCAAGGA CCCTGACTTT TTGCTAATAT TTTTTTATCT TGTTTGAAAG ATCTGCAGAT AACTTGTTCA AAGAGGCTAA
GACCAAGCTT AGCAGTCTCA ATGGAATCAT ATATAGTAAC ATCATACATG CTCACTGGTT AGTATTTGTC AGATTTATAA
ACCTCTTGGA ACTTAACACT GATATGAGAT TGATTTAACA CTAAAGTACC TGTACTTGCA GTCAATCTGG CAATATGGAA
CGGGCTGAAG AACTGGTGCG TGAAATGGAA GAGGATGGGA TAGATGCTCC TATAGATGTA TATCACAGTA TGATGCATGG
ATATACCATC ATTCAGAACG AAAATAAATG TCTAGTTGTC TTTGAACGGC TTAAGGTATA GTGGAAACTG TCTTCTCATG
GGTAACCGAT CTGGCTTTCT TATATTTCTA TTAAGTCCAG TTTGGTCCTC AATCCTTCTT GTGGTCTAAT TTTCATTTCA
TGGCCAGCTT CAAGACCATT TAGTTTACAC AACTAAAATG CCAAAACTGG TACAAATAAC CCCTTGTATT CAAATCATCG
TGTTATTATC CCATTTTACT GTGACAAAGA CACATTGACA ACTTGAATTA CCATTGAGGT TGGTGAGTCA GCACTTTTTT
TTTTTTGAGC AAGGGCGACT GCCCCCATTT CTATTACCCG AAATGGAACA TAGTAGTTTA CAGAGTGCAA GGAAGAAAGA
CATGAAGAAA CAGCATAAGG GCTAGAAAAG ACAACAAAAG GAAGATTACA GGTTTCTCAT TCAACAGGAA TTCCACACCA
CCGTGCATAT GACCCTCCAT CAACCGAAGC CGAAAGCACA AAAACAACCC CTCAACCATA GCAAAAGCTC TTCTGACATC
AGTATGCTGG GCCAAACCAA AAGAACATCA ACTTTCTTTT GTGTTCCTGA AGCCATGTAc cttcatcctt ccagtcttct
cgtcctagtg taccatccat acttcgagct gaaaacatca tttgctacct gccttattag cctggctccc agaagcaact
tttcttgatt tgcctccaac atctgcagca cagcccaagt ttcaatccaa tgacaagtca agtaaactac atcaatggga
tcttAAAACG GATGGGACCT GCCTGCTGTC CTGTTCTGTT TTTGCTCCTT ATCTCTCCCT CCAGATCTGG TAATCTTATA
TCTCCAGGAT CCAAGTTTCT TTCAGATTCC GTCAGTTAGC TATTGTAACC AGTCCCTTGG CCAGACCTCA CCTCTGGTTT
TATTTGGAGC AAACGAAAGT ACCAACTCAA CTCAAAGATA TTTTGGAATT CATGGCTGGT AATCAAAGAC CGATTCAAGT
TAAGAAATTC ATTTCTGGAT TTTCCAGATA GTGAGCAAAA GAAACAATGG GGCACGACAA TTGCAGGCCC ATGGTAGGAA
GCATAGCAGA AGCTGTAGTA GGGCCAGGAG CAGTGAAGTG AGAAGCTTAT CTGCCCTGAT TCTGGCAGCA GCAACAAAGT
GCCAGAAGTC CAGGAGTGGG TGAGAAAGGA GAGGTGGGAA GTGGGAATTT CTGGCCATGG TGGTGCTGCT CAGCCAGAAA
CCTTAGTGGT GCTGACCAGC GATGAAAGTA TGGAACTAAT GTGCTTTGTG ATCATATTAT CCATGGAAGC TACAAGAATG
AAACCACACC CTTTCCTCTC ATTAATTTCT GTATGTTCCT TTTAAATATG CATATGCATT GATGTTTAGG TGTATGAGTA
TTTTTTTGGG AAAATGACCT ATCTGCATAT CACTGCATTG CATATCTGTA CAGTATCGGA GTATCTGGGA AACACAGATG
ATGAAGTTAC TTGATCTGTG GATACAACTT TGTATCATCG AGGATGGTGT CAAGGAAATG AGGAAGAGAA AAAATAAGCA
TATCGCTGTT ATCGGGCCAC ACCACCCTGT GGACTAAAAT GGAGGCGGTT TTAGCTCAGG GATGTAATTT GCACCTGTTT
TGATATTTGG AAGACCTGTG ATAAATGGTT CTAAAGTTTA AGGGTGAAAT ACTGAAACGT AAAATTAGAC TACAAGAGGA
GTTGAGGGAC CAGAGATAGA TGTATTCATA ATTTTTATTT TTTCTATCTC CCCTTCTGAT CTGATTTTTC CTGTTTTTTG
CAGGAGTGTG GCTTTAAACC ATCAATAATC TCTTATGGGT GCCTTCTTAA TTTGTATGTC AAGGTAAAAG TAATTCTGTT
GCGTGCTTTC TTGTCAGTTT TCCTGTAATT TTGTGTGTTC CCTTAGTAGA AGGAAACAAA AAATTGTGCA TCCCAGACAA
GTGTTTTTTT CCCTCGTAAA TTATGATGTT TAAACACTCC TTTCTGCACC ATTGATTTCT ATTCGTTATA TGACTAGTAT
TCTGAATATC TAAGAGTCCT TGGATTCACC TTTTTCTGAA AGCCTAAGGC AAGGGAAGCT TTATGTCGAG TTTCTTATAC
ATTGAACATG ACAATCTTCA ACTTTGAAAC TCAAACCTGC CCCTTTATTA TTAATTGTAA GATAGGTTAC TTGAGACAAC
TCTTAACAGT GATCACTGAT GTTGCTCTGG TTTCTTTTCT TTTCTCTTTT CAGATAGGTA AGGTTGCCAA AGCATTATCT
ATTAGCAAAG AAATGGAGTC TTGTGGCATC AAACATAATA ATAAAACATA CTCTATGCTT ATCAATGGAT TTATCCATTT
GCACGACTTT GCAAATGCTT TCGCCATATT TGAGGAAATG CTAAGATCAG GTCTACAACC TGATCGTGCC ATATACAATT
TGCTTATAGA GGCATTTTGT AAGATGGGAA ACATGGATCG TGCTATTTGC ATTTTGGAAA AAATGCAGAA GGAACGAATG
CAACCATCAA ATAGAGCATT CAGGCCTATC ATAGAGGGAT ATGCAGTTGC TGGTGATATG AAAAGTGCTT TGGATACTCT
TGATCTGATG CGGCGAAGTG GTTGTGTTCC CACTGTAATG ACTTACAATG CTCTCATTCA CGGGCTAGTT AGAAAGCACA
AGGTATTTTT CAAGTACATG CTAGTTTCTT CAAATCTAAT CCTGTCATGT GGCATTTACT TTAAATTTGT GTTTATAGGT
TCAAAGAGCT GTCTCTGTGC TTGATAAGAT GTCCATCGCT GGCATTACAC CAAATGAGCA TACATACACA ATCATTATGA
GAGGTTATGC TGCCAGTGGA GATATTGGGA AGGCTTTTGA ATACTTCACC AAAATAAAAG AGAGTGGTCT AAAACTCGAT
GTGTACATTT ATGAAACATT GCTCAGAGCC TGTTGCAAAT CAGGGAGGAT GCAGAGTGCC TTAGCAGTCA CTCGTGAGAT
GAGCTTCCAA AAGATACCAA GGAATACATT TATATATAAT ATTTTGATTG ATGGGTAGGT GTTCTAGATA AGCTCTTTAG
CCAATGTTTT TACTGACTAG TAACGATCTT TTTACCGACT CAGTACTCAG GGACGCTTGT GACCATTTAT TTATGTGTTG
ACTGCATCGA ACTACTTAGT CAACTGCTGT ACTGACTCAG GGATACAAGA AAGTATTATG GAAAAAAATA ATATAGGGGG
TAGAGAACAA CCCCTCAATA TTTTTAGTAG AAGGTTGTGG TTGAACCTGT GGAGGGCTAG CACAGCGAAC TGTGCTGTTA
GCCAGTAGGT CCTAATAGTC TCCTCACATG AAACTATTAT GATATTTCAT TGGATTAGTC ATACATTAGT TTTGAAAATT
TGTATTATAT ACTGAGTTCA TGTTTTATTT GAGTCTTGCT GTAATTTATG AAGTTTTATA AAAGCGGTAT ATTTTCCTTT
TTGCCTGTTT CGTCACAAAT CCTTTTGTGT AGATGGGCTC GGAGAGGTGA TGTTTGGGAA GCAGAGGACT TGATGAAGCA
GATGAAAGAA GATGGTGTCC CTCCTAACAT CCATACTTAT ACCTCCTATA TAAATGCATG CTGCAAGGCA GGAGACATGC
AGGTACGAGA ATTTTGCATT GGAATACTTA GTTTCTTACT TATTGTGAGT TGTAACCGTG TAGTGGAGAT AGCCTGATTT
TGATAGGATA TGTGCACATG TTTTAAGGTA GCTGACCAAA ATATTTTACA ATGCCATGAC TATATGCCCG AATTATTTCA
GCACTACAGA TTTACCTAGG TGGCTACATA TTCAAATTTG GCACTTGTGA ATGGAGAAGT ATTCTCTTGG GGCCTTCTTG
TAATCTATCC AATTATTTTT TTTTATAAAA TGATTTGTTT GTAGAGAGCA GAAAAGGTGA TTGAAGAAAT GGTAGATGTT
GGACTAAAAC CTAATGTCAA GACATATACT ACCTTGATTA AAGGTTGGGC AAGAGTGTCA CTTCCAGACA GGGCATTGAA
ATGCTTTGAG GAGATGAAAC TTGCTGGGTT GAAACCTGAT GAGGCTTCTT ATCATTGCTT GGTGACTTCA CTTCTGTCAA
GGGCAACTGT AATGGAGGGA AGTACCTACA CAGGAATCAT TAGTGTCTGT AGAGAAATGT CTGAGAATGA TTTGACTGTT
GATCTTCGCA CTGCTGTTCA CTGGTCTAGA TGGCTTCACA AGATTGAGAG GACTGGAGGG GCACTAACAG AAGCGCTTCA
GAGAATATTT CCTCCTGATT GGAATTCATT AGAATTTTTA GGAGAGCCAT CCAGTTCTAT AAGCATGGGG GAGTCTGATG
ATTACAGTGA TTCAGATTTT AGCGGTGATG AAGATGAGGA TCATAATATT GATGATAGCT GAAAAACTCT AGATTCCAGA
GCCTGTTTTT CTTGTTCTGT GCCCTCACTT TTTGTCCTTT GGTTCTGCCA GAGTGGATGA CCGAACAAGG TATTATGTGT
TGAACTGTTA ATATGTGTTT AATATGCCAT TTCCTTTTGG TGATGTTTCT AAAAAGCACA CATAATAATT CTTGAAAAGG
AGTCTGCCAA CAATCATTTG TCATTACTCA ttgccacttt ttggagttcc tggaaattgc attgaactaa cactctttgt
ttccatggca gcaatgtctt tgatcaaact gtgccctcac attcagacac cagtggcttg tggactatcc aagagcgttt
ggaatcttat agtgcaataa gcgtgagctg gctggcctct gctgcgtttc ttcaagagca acagtcagta acagttctac
tgggactgaa gacacaggct gtcaatgcaa cagacgaagc ttactcagtt atgcgtgtag ctgtacatAT CAATGGCTGG
CACAGGTAAA TATTCTTGAG ATATTGACAG ATTCAATTGT TGTTTCTCTC CATCCTTTCA GTATAGTCCA ACTTGATATA
AAATCCAATT CCATATATAT GTGTATAAAT GCAAGTAAAG CTATACCACG TTACCAGTTA CCACCCACAC CCCTTCTTGG
CTTGCCTTTT GTAGTGTGCC ATGTGAAATG TACCGACCAT GATAGAGCCT GCGTGCCCAT TTTTCAACAT CCAAATGTTA
GGAGTGGTAG GAGCGCTTAT AGGCATATGC TTGAACACCA CTTTGATTGG CAGAATTTTG TAGGGGCAGC ACAGTGTGCC
TACAAGGTTT GGTTTTGTAA CCACATCCCT GGACAAGCCG TTCGATGCTT ATTTGAATAC TAGTACGACA AACCAATCTG
TGTCGTGGTG CTCGTAAAAG CTGAGATCAT TTAAACTTGT AAGTAGAAAG TTGGACGAGC TTTTTTCTCT TCGAGAGAAT
GCACAGGCCC TCATGTTCTT TGTTTTGATG ATCTTAAAAA AACCATAGTC AAGGTAAATA GGAGCAAAGA TTGGTATCTT
GCACATTATT GCGGGTTGGG CTTATTCAAT GGGGGAATTC CCTATTGAAA CTGAAGTACA AGTCCAATCA AGTGCTAGAT
GATGACTGTT TTCTCATTTA AGGTTTGGCA TCTTCCAGTA CAGCAGCTTC AATCAAATGG GCCTTAACGT AGCTCAGCCC
GATTCAATAT TACTTGGAAT TGCACGCCTC TGTCCAAGCT GAAAGCTTTT ACTAGTAGGA CACTTGAATG CCTGCACAAG
ACGGCATTAA TGCTGTGCTT ATGAGCCCGA TTTCTTGAGA CTGGTGTTGA GTTTGTGCGT ATGTGTGTGC TATGAGCTGC
GAATCTTAGC TGGCCGGTAT CTTTCATTGA ATCGAAAGTG GCCTCCCCAT TCAAGTCTTG CCCACAAGAT AAAACAGTGC
TTCATTTATG CCTGTTATTT AATTTTGCTT AGCTGCATCT CGCTTCTCCA TTCATACACC ATAAATTCTT TCAAAGAAAT
CTTGATTGTA TTAGTGTTGT ATTAGGCCTT TGTTCGGAGA GAAAATTTCA TAGTACCAAT taccccctcc atcccaaaat
ataataactt ctatcactaa gagtttgttc caaaataaaa taacttatcc accaacattc tcttcctaac taatcataac
cctgcaccat ttaatttttc catctacctc cacttctcaa ccaatcacaa tatcatcata tttaattcta tctactttct
taataattgt gtttaatcct aaaatttctt atgttctggg acggagatag taGCATGTAT GAACAGTATG AAGTACTACA
ATGTAAATAT TTTGCCTGAA ACATGCTTTG TTTTTTTTCA TGCCAAATAA TTCAGTGTGA TATTTGGTAA TTCATACAGT
ATTCCTTCCT TTTATACCCA CTCTAGTTTC AAATACTTGT CACTAGTTAC TACTTACTAC TAGCTTTTTT CCCTAAAAAA
GTTACTAGCT TTTTAGCTTT GATCACTCGC CCTTTTTGCA AAAATGAAAC ATATGTATAC TTAAAATATG TTGCATTAGC
GATGTGTGTT CCATAAATAC AACCAGACAA CTTTCACTAA TAATAACTTA ATCTTTAAAA GTTATTAATG GTTAAAGGTG
AAACATTATG GTTAACATTG ACAAGTAAAT AAAGATGGAA GGAATACATA TTTTCTAAAG ATAGGTACGG TCCTACAGGC
TTTGTCCAGC AAAAAAAAAA GGACAGTTCT GCAGAACAAA AATATTTTGG TGGAGTTTTT AAACATTGCA TCCAACAGAA
GCCTTATGGT ATATTTTTTT TCTATGATAA GAGAATTTAT TCTGGTTTTT TACTTAAAAG AAGCTGCAAC CAATTATTAT
AGAATTTGCA GAATGAATAG CTGCGGATTA CAAAATTATG AAACACAAAG TAGAAAACTA CTAAGAATAC CACCCTTAAA
ACAAAGATCT ACATCTATGG TTAGTCAGAG gggagtagat tctaatccct cgaggggata tcccttcgta tatctttttc
ttccaaattc gatgcaaata gttgtgaaaa attctgaaaa aaattgacaa cgtagagtat aatgatacct actagtccac
caaaattcat gttcaaattc gatctacaca tcgagaaaca aaaaagacaa atttagatat aaacagtacg ttactattca
tacgctgaat ttgtcttttt tatatctcga cgtgggagtt gagtttggac ttaagatttt gtgaagttgt atatatgtgt
tgtatgaatg ttgtcaaatt tttccagaat ttttcataac cgtttagatg gtttttgagc aaacgagcga acatcccctc
gagggattag aatagtttcc cTTAGTCAGA GTATGTTTAA CGTTGTTTGC TCCAATGGTT ATAAGTTGTA CAGTCTCTGA
AACCAGCAGC CGATCTTTGT CGATCGAATT TCGATCCCAT CACTGCCGAT GAACTGACAT TGAACCAAAA CGGAAGAAGC
CTTATGGTAT GGGTGGAGAA TGAAAATAGG AAAGAGACAG GAAACATCTT TATTCCTAAA CTAGtactcc ctccgtccca
taatataagg gattttagag gtatgtgatg tttcctcgga ctacgaatct agatcacatc cctctaaaat cccttatatt
atgggatgga gagagtaACA ATTAATAGGA AATGACACAA CAGGATAGCA GAAACTGAAA ACTTCCTTTC ATTTTCTGGG
GAAAAAAGGG GAAATTTGAC GTTTGGAGCT CATCTGTAGT GGAGATTTAA CTGTTCCAAA AGTTTAGAAT AGTGGCAGCT
ATGTTGATAC AGCACTATGT TATCTTTTCT CAGCAGACGT GCTGGTAAAA AAAATTTAGT GCGAAGGGAC CATTGCTAGT
TGGCCCTTAC TTTTATATTA CTGTAACTGA TCCAGAATTA AATTTCTACC TATTTTCTTT GAAAGAGCAC GAAAGCACAT
ATCAATAATT TTGGTAATAT TATTCATTTA TCATAATCTA TTTTGCTATA CGCTCCGACC ACTGCACAAT GACAGTATTT
ATTTCGCAGA GAGGCCAACA GGAGCTATAA AATGATGTTC CGATTGCTGT TAATTACCTG GAAACTGTAC TGTACTGGGC
GAGTGATGAA GGTAGGATGG AAGCGCCAAG CTGCTGTGAA CAACTGAGGG AAAATTCAGG TGTAATTTCC TCTCTAGTCT
CTAGAATTAC AAGGCAAGGT ATATATTTTT AACGTTTTTG TTTATGAATA GAAGATGAGC TATGCTTAGA TTATGGATTG
TATAGTACCC GCCCATTGAG GCTGGGCTGG GTCCTCCAGA ATATATACCC CTGCATGTGT CACTGACATC ATTTGGTCGA
CATGATAGAA ATATTTGGGA GCAAACCCTA GTAAGTGCAC TCATAGTAGG GTATAACTAA TACTCTATTT GTATAAACTA
TAAAGAAATG CAAGTACCAC CCGCTAACTG AATTAGTAAT TGCTATAAGG AGTTCTCACG TTTATTTAGC CACGTGATCA
TCAAACTGAG CCATCCATTG GACAGAAGTG TCTGTGAGAT ATCAATGGTT AGTATATGAT TGTCAGTAAA GGGGTTCTAT
CAACGTAACT ATATACAGGA TGTGATGATC TCTAGCCACC TGTAAATATG TTTTGCAAAA TACTGTACTC CTAATTAAAG
GGAGTTAGCT GTTGTAGCAT TCAAGTcact ggtggagaaa ccatctttgg tcggtcggcc gaaatccaca atagtctcgg
ttccactaaa aaccgggact aaagatcatc tttagtcccg gttgatggct acagcgggca tatttgatct ttagtcccgg
ttggtgttat caaccgggac taaaaataat ctttagtccc ggttctaaac ctatcaggcc ttgtcaggcc ccccgggatc
tttagtcctg gttggtgtta ccaaccggga ctaaaaatag gctctttagt cccggttggt gttaataacc gggactaaag
atcccgagga tagcgcacgc accagcccac gcttctctct ctgaaccttg tgcatgcgca gcctctctct ccacccttat
ctctttttat tttccttcct tatcttcatc ctctccatcc ttctccttcc atcctcccct tctcttctct caccccctct
cctcctcccc ttgcagaggc agccggcggc ggcgggatgg aggccgggcg caggctagcg gcggcgggat ggaggtcggg
catgggctgg cggcgggcgg ccggtggcgg cgggatgaag gccgggcgcg ggctagggct ggcggcggga tggcggccga
gcgcgggttg aggctggcgg ctgtgccggc ctggctggtt tgccgtgcct gagctgcggt gctggtgtgc ttggcggcgt
gctggccggc ggcgacggga tgtgctggcc gggctgctgg gctgggtgct tggcggtgtg tccggcgctg ggtcggcgtg
gattgaggcc gttctgccgt gctgtgccct cgcccccccc ccccctcccc tagatccggc cggatctgga gcggcgggat
gggtggccgg ccggcggcgg gatgggaggc cgcccggtga gtcttttttt tgattttttt tatttgtggt ttggatgttt
ttatctgtga ttgaatgtat gaatctgtga tgtggtgact gagtatgtga ctcgatgttg tcaatgaacc tatgaatcaa
tattgtgaat atatttgtga tgttgtgaac g