Os05t0102000-01

Locus

Os05g0102000

Description

Jasmonic acid carboxyl methyltransferase, Regulation of plant development and herbivory-induced defense response, Resistance to brown planthopper (BPH)

RAP-DB Gene Symbol Synonym(s)

OsJMT1

RAP-DB Gene Name Synonym(s)

Jasmonic acid carboxyl methyltransferase 1

CGSNL Gene Symbol

JMT1

CGSNL Gene Name

JASMONIC ACID CARBOXYL METHYLTRANSFERASE 1

Oryzabase Gene Symbol Synonym(s)

OsJMT1

Oryzabase Gene Name Synonym(s)

Jasmonic acid carboxyl methyltransferase 1

Transcript Evidence

AK064690

Protein Evidence

Q9FW31

Literature

PMID: 26466818

Note

Manual Curation

December 18, 2020

Gene Ontology (GO)

Molecular Function: methyltransferase activity (GO:0008168)

Functional domain (InterPro)

Methyltransferase, alpha-helical capping domain (IPR042086)

S-adenosyl-L-methionine-dependent methyltransferase (IPR029063)

SAM dependent carboxyl methyltransferase (IPR005299)

Experimentally confirmed subcellular location

cytosol (GO:0005829)

Full-length cDNA

002-116-E07 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0102000-01)

RiceXPro (AK064690)

Others

Oryzabase (20398)

KEGG (Os05t0102000-01)

Transcript

1836 bp

>Os05t0102000-01 Jasmonic acid carboxyl methyltransferase, Regulation of plant development and herbivory-induced defense response, Resistance to brown planthopper (BPH)
ATGCTGTTGTGAGTAGTGATTAGCTAGGCGGCTATTAGCAGCAGCAACCAGTTCTTTTTG
CGTATGATAGATGATGCAGAGTGCAGCTGGAGCAATGGAGCTGCTGGTGGCGTCGCAAGA
AGCAGGCGGCGTTGTGGTGGTGGGCATGAACAGTggcgacgccggagagctgagctacgc
caacaactcggacatgcagcggacgatcgctgcggcgacgaggaaggagcggcaggagat
ggcggcggccgttcggcgcggtcggcggcaggcgagagcCATAGCCATCGCCGACCTCGG
GTGCGCCACAGGGCCGAACGCGCTGCTGATGGCCGGCGACGCCGTTGAGGCCATGCTGGG
CGACGCGGAGCGGCAGCAGGAGGCGGCGCCTGCAGAGTTCCACGTCTTCCTCAACGATCT
CCCCAGCAACGACTTCAACAGCGTGTTCCGGCAGAAGCAGAAGCTGGTGGTGCCGAGCAA
TAATGCCAATAGCAGCCGGTGCCTGGTGTCGGCGTGGCCGGGGTCCTTCTACGGGCGCGT
GTTCCCGGCGGATAGCCTGGACTACGTGGTGTCGTCGTCGAGCCTCCACTTCCTGTCTAG
GGCACCCGCAGATGCGGCGCCCAACGAGGGGAGGATGTACGTGTCGGCGTCGTCGAGCTC
GAGCTCCAGCTCCAGGGTGCTGCACGCCTACAGGGCTCAGTTCCAGGCCGACTTCCGCCT
CTTCCTCTCCTGCCGCGCCGAGGAGGTCCGCCGCGGAGGCGTCCTCCTCCTCACCTTCGT
GGCCAGGCGGGAGGCGGTGCCCTCGCCGCACGACTGCCACCTCTGGGACCTGCTCGCCGA
GGCCGCCGCCGACGACAGGAGGCTCGTCGACTCCTTCGACGCGCCCTTCTATGGGCCCTG
CCCGGAGGAGCTGAGGGAGGCCATCCGCGAGGAGGGGTCCTTCCAGGTGACGAGGATGGA
GCTCTTCGAGGTGAGCCGCTCCCGCTCATGCCAATCCCAAGCAGATCTAGATCAGCTGGC
GGCTCAGACAAGCAGCACCATCAGGGCGGTGGTTGAGCCTATGCTTGGACCACACTTCGG
GTGGGACGCCATGGACGCCCTCTTCCGGAGGTACACCCACCTGCTCCACAATTACTACCG
CCACAACAACGACCAGCTCACCAACGTCTTCCTCGCCTTGCACAAGATTTGACTTCATTC
ATCCCATCCTTCCTTCCTTCAACCATATATATATACCACATTCCCTACAGTATCAGTATG
TATTACTGTATTTCCAAAACGTACCTACAATATATACCACGTGTCAGTTctacgatatat
atatactacccggataaaatgatagtatcgtttctaaaatcgggataccaactgtttcat
gtactagacaatatttaaattcaaaactatttaagtgtatttgtgtttatgtatcttcaa
aatcaatcttaaataaaattattagaactagtgagtggctttctcttgacaaatgtctct
tttcatgtactattctatttatttagaatggctatatatatttaatataaatattaaatt
aaacttaaaaaaataaaatattatatatcccgatactacgatgcgattaaacaatccgat
actacTCACCTTCTACATGTTCAAAGTGTATAGTACAACTTCCATTCTAGCAGTATATTA
TATACTAGTATATATCTGTTCAAAGTGTATAGTACAACTTCTCTTCTAGATGTGATCCTC
CTATCTTATTATAAATATGTTTTTATTGTGTTTGTGTTGTAATTAACATATATAAATCTG
TTGTGACTGGAATGGATTTTAAACCTCTTGAGGGAT

CDS

1122 bp

>Os05t0102000-01 Jasmonic acid carboxyl methyltransferase, Regulation of plant development and herbivory-induced defense response, Resistance to brown planthopper (BPH)
ATGATGCAGAGTGCAGCTGGAGCAATGGAGCTGCTGGTGGCGTCGCAAGAAGCAGGCGGC
GTTGTGGTGGTGGGCATGAACAGTggcgacgccggagagctgagctacgccaacaactcg
gacatgcagcggacgatcgctgcggcgacgaggaaggagcggcaggagatggcggcggcc
gttcggcgcggtcggcggcaggcgagagcCATAGCCATCGCCGACCTCGGGTGCGCCACA
GGGCCGAACGCGCTGCTGATGGCCGGCGACGCCGTTGAGGCCATGCTGGGCGACGCGGAG
CGGCAGCAGGAGGCGGCGCCTGCAGAGTTCCACGTCTTCCTCAACGATCTCCCCAGCAAC
GACTTCAACAGCGTGTTCCGGCAGAAGCAGAAGCTGGTGGTGCCGAGCAATAATGCCAAT
AGCAGCCGGTGCCTGGTGTCGGCGTGGCCGGGGTCCTTCTACGGGCGCGTGTTCCCGGCG
GATAGCCTGGACTACGTGGTGTCGTCGTCGAGCCTCCACTTCCTGTCTAGGGCACCCGCA
GATGCGGCGCCCAACGAGGGGAGGATGTACGTGTCGGCGTCGTCGAGCTCGAGCTCCAGC
TCCAGGGTGCTGCACGCCTACAGGGCTCAGTTCCAGGCCGACTTCCGCCTCTTCCTCTCC
TGCCGCGCCGAGGAGGTCCGCCGCGGAGGCGTCCTCCTCCTCACCTTCGTGGCCAGGCGG
GAGGCGGTGCCCTCGCCGCACGACTGCCACCTCTGGGACCTGCTCGCCGAGGCCGCCGCC
GACGACAGGAGGCTCGTCGACTCCTTCGACGCGCCCTTCTATGGGCCCTGCCCGGAGGAG
CTGAGGGAGGCCATCCGCGAGGAGGGGTCCTTCCAGGTGACGAGGATGGAGCTCTTCGAG
GTGAGCCGCTCCCGCTCATGCCAATCCCAAGCAGATCTAGATCAGCTGGCGGCTCAGACA
AGCAGCACCATCAGGGCGGTGGTTGAGCCTATGCTTGGACCACACTTCGGGTGGGACGCC
ATGGACGCCCTCTTCCGGAGGTACACCCACCTGCTCCACAATTACTACCGCCACAACAAC
GACCAGCTCACCAACGTCTTCCTCGCCTTGCACAAGATTTGA

Protein

374 aa

>Os05t0102000-01 Jasmonic acid carboxyl methyltransferase, Regulation of plant development and herbivory-induced defense response, Resistance to brown planthopper (BPH)
MMQSAAGAMELLVASQEAGGVVVVGMNSGDAGELSYANNSDMQRTIAAATRKERQEMAAA
VRRGRRQARAIAIADLGCATGPNALLMAGDAVEAMLGDAERQQEAAPAEFHVFLNDLPSN
DFNSVFRQKQKLVVPSNNANSSRCLVSAWPGSFYGRVFPADSLDYVVSSSSLHFLSRAPA
DAAPNEGRMYVSASSSSSSSSRVLHAYRAQFQADFRLFLSCRAEEVRRGGVLLLTFVARR
EAVPSPHDCHLWDLLAEAAADDRRLVDSFDAPFYGPCPEELREAIREEGSFQVTRMELFE
VSRSRSCQSQADLDQLAAQTSSTIRAVVEPMLGPHFGWDAMDALFRRYTHLLHNYYRHNN
DQLTNVFLALHKI*

5'UTR

chr05:118199..118268 (- strand) : 70 bp

CDS

chr05:117077..118198 (- strand) : 1122 bp

3'UTR

chr05:116433..117076 (- strand) : 644 bp

FASTA

>Os05t0102000-01 class=Sequence position=chr05:116433..118268 (- strand)
ATGCTGTTGT GAGTAGTGAT TAGCTAGGCG GCTATTAGCA GCAGCAACCA GTTCTTTTTG CGTATGATAG ATGATGCAGA
GTGCAGCTGG AGCAATGGAG CTGCTGGTGG CGTCGCAAGA AGCAGGCGGC GTTGTGGTGG TGGGCATGAA CAGTggcgac
gccggagagc tgagctacgc caacaactcg gacatgcagc ggacgatcgc tgcggcgacg aggaaggagc ggcaggagat
ggcggcggcc gttcggcgcg gtcggcggca ggcgagagcC ATAGCCATCG CCGACCTCGG GTGCGCCACA GGGCCGAACG
CGCTGCTGAT GGCCGGCGAC GCCGTTGAGG CCATGCTGGG CGACGCGGAG CGGCAGCAGG AGGCGGCGCC TGCAGAGTTC
CACGTCTTCC TCAACGATCT CCCCAGCAAC GACTTCAACA GCGTGTTCCG GCAGAAGCAG AAGCTGGTGG TGCCGAGCAA
TAATGCCAAT AGCAGCCGGT GCCTGGTGTC GGCGTGGCCG GGGTCCTTCT ACGGGCGCGT GTTCCCGGCG GATAGCCTGG
ACTACGTGGT GTCGTCGTCG AGCCTCCACT TCCTGTCTAG GGCACCCGCA GATGCGGCGC CCAACGAGGG GAGGATGTAC
GTGTCGGCGT CGTCGAGCTC GAGCTCCAGC TCCAGGGTGC TGCACGCCTA CAGGGCTCAG TTCCAGGCCG ACTTCCGCCT
CTTCCTCTCC TGCCGCGCCG AGGAGGTCCG CCGCGGAGGC GTCCTCCTCC TCACCTTCGT GGCCAGGCGG GAGGCGGTGC
CCTCGCCGCA CGACTGCCAC CTCTGGGACC TGCTCGCCGA GGCCGCCGCC GACGACAGGA GGCTCGTCGA CTCCTTCGAC
GCGCCCTTCT ATGGGCCCTG CCCGGAGGAG CTGAGGGAGG CCATCCGCGA GGAGGGGTCC TTCCAGGTGA CGAGGATGGA
GCTCTTCGAG GTGAGCCGCT CCCGCTCATG CCAATCCCAA GCAGATCTAG ATCAGCTGGC GGCTCAGACA AGCAGCACCA
TCAGGGCGGT GGTTGAGCCT ATGCTTGGAC CACACTTCGG GTGGGACGCC ATGGACGCCC TCTTCCGGAG GTACACCCAC
CTGCTCCACA ATTACTACCG CCACAACAAC GACCAGCTCA CCAACGTCTT CCTCGCCTTG CACAAGATTT GACTTCATTC
ATCCCATCCT TCCTTCCTTC AACCATATAT ATATACCACA TTCCCTACAG TATCAGTATG TATTACTGTA TTTCCAAAAC
GTACCTACAA TATATACCAC GTGTCAGTTc tacgatatat atatactacc cggataaaat gatagtatcg tttctaaaat
cgggatacca actgtttcat gtactagaca atatttaaat tcaaaactat ttaagtgtat ttgtgtttat gtatcttcaa
aatcaatctt aaataaaatt attagaacta gtgagtggct ttctcttgac aaatgtctct tttcatgtac tattctattt
atttagaatg gctatatata tttaatataa atattaaatt aaacttaaaa aaataaaata ttatatatcc cgatactacg
atgcgattaa acaatccgat actacTCACC TTCTACATGT TCAAAGTGTA TAGTACAACT TCCATTCTAG CAGTATATTA
TATACTAGTA TATATCTGTT CAAAGTGTAT AGTACAACTT CTCTTCTAGA TGTGATCCTC CTATCTTATT ATAAATATGT
TTTTATTGTG TTTGTGTTGT AATTAACATA TATAAATCTG TTGTGACTGG AATGGATTTT AAACCTCTTG AGGGAT

Locus: Os05g0102000

Loading...

Locus: Os05g0102000

Loading...