Os05t0103200-01

Locus

Os05g0103200

Description

Cyclophilin, Mediation of chilling tolerance and cell elongation

RAP-DB Gene Symbol Synonym(s)

OsCYP20-2

RAP-DB Gene Name Synonym(s)

cyclophilin 20-2

CGSNL Gene Symbol

CYP20-2

CGSNL Gene Name

CYCLOPHILIN 20-2

Oryzabase Gene Symbol Synonym(s)

OsCYP20-2, OsCYP-11, OsNuCYP20-2

Oryzabase Gene Name Synonym(s)

cyclophilin 20-2, rice thylakoid lumenal cyclophilin OsCYP20-2, cyclophilin 11

Transcript Evidence

AK119201

AK061557

Protein Evidence

Q75M32

Literature

PMID: 31736073

PMID: 22041789

Note

Manual Curation

November 22, 2019

Gene Ontology (GO)

Biological Process: protein peptidyl-prolyl isomerization (GO:0000413)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Cyclophilin-like domain superfamily (IPR029000)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain (IPR002130)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved site (IPR020892)

Experimentally confirmed subcellular location

chloroplast (GO:0009507)

nucleus (GO:0005634)

Full-length cDNA

001-041-D05 (Online Clone Ordering)

006-311-C10 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0103200-01)

Others

Oryzabase (10023)

Transcript

1125 bp

>Os05t0103200-01 Cyclophilin, Mediation of chilling tolerance and cell elongation
ATTCATCCCAGTGCAATGCCCTATCTACCTATCCAATCCCAATCCACCTGAGCGAGAGAG
AGAGAAAGGGTCTCCTCCTCAACATCAACAATGGCGGTCGCAACCTCCTTCGCCACACTC
GCCATCGCGCGGCCGGCGGCGGAGCGGGCCCTCCtcgcctccaaaaccccctcgccgctc
ctctccatccgcaccggcaccggcaccgcacgcCTCCCCTCATCGGCCGTCTTTGGAGGT
TTCACTCCTGCGCTTTCCGCTGCTCACAGCCGCGCGCGCTTCGTCTCCTCCGCCACCGCT
GACCCCAAGGAAGTGGACCTCCAGTCCAAAATCACAAACAAGGTGTACTTTGACATAAGC
ATCGGAAACCCTGTTGGGAAGAACGTTGGGAGGGTCGTTATTGGCCTATACGGGGATGAT
GTTCCCCAGACCGCAGAGAACTTCCGTGCTCTTTGCACTGGAGAAAAAGGGTTTGGTTAC
AAGGGGTCCAGTTTCCACCGTGTCATTAAGGACTTCATGATTCAGGGAGGAGACTTTGAC
AAGGGCAACGGTACTGGAGGGAAAAGCATATATGGCCGGACCTTCAAAGACGAGAACTTC
AAATTGGTTCATACTGGACCTGGAGTGGTCAGCATGGCCAATGCTGGGCCAAACACCAAT
GGCAGCCAGTTCTTCATCTGCACTGTCAAGACACCTTGGTTGGATGGGAGGCACGTCGTG
TTTGGGCAGGTTATTGAAGGCATGGACATCGTTAAGATGATCGAATCGCAGGAGACTGAC
AGAGGGGACCGCCCGAAGAAGAAGGTGGTCATCAGTGAGTGTGGGGAGCTTCCAGTGGTC
TAATAGGTGCCAGAGGGCTAATCTTCTTCCCCCGGAGACTTTGCTGTTTTTGGTTTCATA
GTAAGCTGTGAACTTATCGCATGTTCTCCGCGCAGTCAGAGATCATGCTGAGTTGAGGCC
AAGATTTCTAAGTTGAGAAGAATCCTCTATTGTTCGGCTGGAATAAAACGTTCTTACCTG
TCGAGGGTCAGGAAATAATGTTGTGGTTCATGAAAGATCAAATGTCTGTCTTTTCGTGCA
TACGCAGACTAAAGTTACTcctttcccaataccttttgttgctgc

CDS

753 bp

>Os05t0103200-01 Cyclophilin, Mediation of chilling tolerance and cell elongation
ATGGCGGTCGCAACCTCCTTCGCCACACTCGCCATCGCGCGGCCGGCGGCGGAGCGGGCC
CTCCtcgcctccaaaaccccctcgccgctcctctccatccgcaccggcaccggcaccgca
cgcCTCCCCTCATCGGCCGTCTTTGGAGGTTTCACTCCTGCGCTTTCCGCTGCTCACAGC
CGCGCGCGCTTCGTCTCCTCCGCCACCGCTGACCCCAAGGAAGTGGACCTCCAGTCCAAA
ATCACAAACAAGGTGTACTTTGACATAAGCATCGGAAACCCTGTTGGGAAGAACGTTGGG
AGGGTCGTTATTGGCCTATACGGGGATGATGTTCCCCAGACCGCAGAGAACTTCCGTGCT
CTTTGCACTGGAGAAAAAGGGTTTGGTTACAAGGGGTCCAGTTTCCACCGTGTCATTAAG
GACTTCATGATTCAGGGAGGAGACTTTGACAAGGGCAACGGTACTGGAGGGAAAAGCATA
TATGGCCGGACCTTCAAAGACGAGAACTTCAAATTGGTTCATACTGGACCTGGAGTGGTC
AGCATGGCCAATGCTGGGCCAAACACCAATGGCAGCCAGTTCTTCATCTGCACTGTCAAG
ACACCTTGGTTGGATGGGAGGCACGTCGTGTTTGGGCAGGTTATTGAAGGCATGGACATC
GTTAAGATGATCGAATCGCAGGAGACTGACAGAGGGGACCGCCCGAAGAAGAAGGTGGTC
ATCAGTGAGTGTGGGGAGCTTCCAGTGGTCTAA

Protein

251 aa

>Os05t0103200-01 Cyclophilin, Mediation of chilling tolerance and cell elongation
MAVATSFATLAIARPAAERALLASKTPSPLLSIRTGTGTARLPSSAVFGGFTPALSAAHS
RARFVSSATADPKEVDLQSKITNKVYFDISIGNPVGKNVGRVVIGLYGDDVPQTAENFRA
LCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVV
SMANAGPNTNGSQFFICTVKTPWLDGRHVVFGQVIEGMDIVKMIESQETDRGDRPKKKVV
ISECGELPVV*

5'UTR

chr05:185654..185743 (+ strand) : 90 bp

CDS

chr05:185744..185773 (+ strand) : 30 bp

chr05:185873..186061 (+ strand) : 189 bp

chr05:186814..186964 (+ strand) : 151 bp

chr05:187069..187157 (+ strand) : 89 bp

chr05:187736..187790 (+ strand) : 55 bp

chr05:187878..187963 (+ strand) : 86 bp

chr05:188050..188202 (+ strand) : 153 bp

3'UTR

chr05:188203..188484 (+ strand) : 282 bp

FASTA

>Os05t0103200-01 class=Sequence position=chr05:185654..188484 (+ strand)
ATTCATCCCA GTGCAATGCC CTATCTACCT ATCCAATCCC AATCCACCTG AGCGAGAGAG AGAGAAAGGG TCTCCTCCTC
AACATCAACA ATGGCGGTCG CAACCTCCTT CGCCACACTC GTAAGCTCAC TCATCCATGG CCTCTGCTCT CCTCTTCTTC
CCCACCGAGC TCTCAATCTT ATTATCGTCG CTCTTTCTTC TCTTGTGTTT GCACTGCAGG CCATCGCGCG GCCGGCGGCG
GAGCGGGCCC TCCtcgcctc caaaaccccc tcgccgctcc tctccatccg caccggcacc ggcaccgcac gcCTCCCCTC
ATCGGCCGTC TTTGGAGGTT TCACTCCTGC GCTTTCCGCT GCTCACAGCC GCGCGCGCTT CGTCTCCTCC GCCACCGCTG
ACCCCAAGGT ACTGTGTCCC CGGATCTTCT TCTTTTATCT GCCCTACATA TATCTTTCTA TTGCCGCACC GCATCCATTC
TTGTAATCCT GTCTAGTAGT ATATCAGTCA AATTTACTAC TCCACCTTAC TGGACTATTA TTATGCAATC AGCCTCCGCA
ATACCGGCCC CTGTTTGTTG CCTCTTTGGA GGAAGAGATA TTGGGTTAGC ACAGATGACC TCGACCTTCC AACACCATTA
AATTAAAACT AATACTAGTA ATGCCTTTGT ATGTCAAATT TTGTTATCAG ATTTTTAAAT CACCAGGTGA AATTTATGCT
ACCAAAATTG CAGTTTCAGG CTTATCATCA CCAATGCTTT ATTATGTATT CACCTGCTCT GATTAATAAT TTTAGTTGCC
TCGACCATAG GGTTCTGCTA CTTACAGGTC TTACCTTGTA TGTGCACCGA ATGTAAACAC GTTATTCATC ATCAGTGACT
GCCTGCAACA TTGTGAGGAA ACACGTGTGC CCTTCTGTAC TACTGAAAGC TGGGTTTTCC TTTCCCATGT GCACTATGCG
CTTTCATGTT TTCCTCCACT AGATGTTAAC TTACGATATA CTACCTCCTT CCTTTAATAT ATGACGTTGG TTAGTTCAAT
TAACATCATA CATAAAAGAA CAGCGCAAGT ATCGATTATT CTTACCCTAT GTGGGAGAAC TGGATACCAC GCTTCAAATT
TATTCTTTCA GTTTTGCTAA ACTTCTCCCA TACATTGCAG GAAGTGGACC TCCAGTCCAA AATCACAAAC AAGGTGTACT
TTGACATAAG CATCGGAAAC CCTGTTGGGA AGAACGTTGG GAGGGTCGTT ATTGGCCTAT ACGGGGATGA TGTTCCCCAG
ACCGCAGAGA ACTTCCGTGC TCTTTGCACT GGTACAAAGG GCTTCTTGCT TTTCTTCTCT TCTGTCATCT ACTACTTTAC
AGGATTACCC AGATTTGGTG CATGATACAC ATACCATTGC CCTTTTCCTT TTCAGGAGAA AAAGGGTTTG GTTACAAGGG
GTCCAGTTTC CACCGTGTCA TTAAGGACTT CATGATTCAG GGAGGAGACT TTGACAAGGG CAACGTATGT CTTCATTATT
TACTTTCTTT ATAATCTACT CCTATGTTGC ACTTGTTCCT CTGTTTCATC TGACAAACTC TATTGGAAAA AGTCACATAG
TGTAACATTA CTCACAACAC TGAATGAGCT CATGTGTTTG TTTCTATCTA TCACCATTGA GCCAACTATT TCTCCAAAAA
AAAAAAAGTT TGATTTGTTT TATCAATGTT AGCGCTTTAT GCTGTTTTGG ATAGAAAGCT GACCTATATA TGTGTTTTGG
ATCATTATAC AACTTTGTGT TATGCACTTC AGTGCTTGCC CTATGGTGTT TTAGATCATT ATACTGCTTT GCATCATGTA
CATTATGAGT ATGAATTGGT AGTTTGTGAT CAGCATAATG TGTATGCAGT GATTATTGAC TTCATGGCTA GATTACAAGG
AGATTAGCAC CAAATCCTTT TTCTTTAAAT TGATGGCCTA AATTAAATCA TGCAGCTGCC TGGTTTCATG AATTATGAAT
TTTTGACCTA GCCTACATCA AATCATTCAG CTTTCAACTT CTGCATGTGG ATAAAGTAGG TTTCAAAAAA TGAATATTTC
AGGGTACTGG AGGGAAAAGC ATATATGGCC GGACCTTCAA AGACGAGAAC TTCAAATGTA CGTCTGACAA ATGACCTAAT
CTGATCGTTC TTTCTGCTTC TTATCTTGTG GTTGTGCTGA TTATATGTCT TGTAATGTTT GTAGTGGTTC ATACTGGACC
TGGAGTGGTC AGCATGGCCA ATGCTGGGCC AAACACCAAT GGCAGCCAGT TCTTCATCTG CACTGTCAAG GTAACACTGT
ACTGATATGT TCACTGTGTA CTAGTGTCGA AACTCACTCA AAATTACATT GCGCTGACTG CTACCTGCGA ATGCAGACAC
CTTGGTTGGA TGGGAGGCAC GTCGTGTTTG GGCAGGTTAT TGAAGGCATG GACATCGTTA AGATGATCGA ATCGCAGGAG
ACTGACAGAG GGGACCGCCC GAAGAAGAAG GTGGTCATCA GTGAGTGTGG GGAGCTTCCA GTGGTCTAAT AGGTGCCAGA
GGGCTAATCT TCTTCCCCCG GAGACTTTGC TGTTTTTGGT TTCATAGTAA GCTGTGAACT TATCGCATGT TCTCCGCGCA
GTCAGAGATC ATGCTGAGTT GAGGCCAAGA TTTCTAAGTT GAGAAGAATC CTCTATTGTT CGGCTGGAAT AAAACGTTCT
TACCTGTCGA GGGTCAGGAA ATAATGTTGT GGTTCATGAA AGATCAAATG TCTGTCTTTT CGTGCATACG CAGACTAAAG
TTACTccttt cccaatacct tttgttgctg c

Locus: Os05g0103200

Loading...

Locus: Os05g0103200

Loading...