Os05t0103200-02

Locus

Os05g0103200

Description

Cyclophilin-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP20-2

CGSNL Gene Name

CYCLOPHILIN 20-2

Oryzabase Gene Symbol Synonym(s)

OsCYP20-2, OsCYP-11, OsNuCYP20-2

Oryzabase Gene Name Synonym(s)

cyclophilin 20-2, rice thylakoid lumenal cyclophilin OsCYP20-2, cyclophilin 11

Transcript Evidence

AK104772 (DDBJ, Best hit)

AK104195 (DDBJ, Best hit)

AK104478 (DDBJ, Best hit)

AK104627 (DDBJ, Best hit)

Protein Evidence

A2XZE6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type, conserved site (IPR020892)

Full-length cDNA

001-039-A09 (Online Clone Ordering)

006-303-G10 (Online Clone Ordering)

006-301-F07 (Online Clone Ordering)

006-310-B08 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0103200-02)

Others

Oryzabase (10023)

Transcript

1076 bp

>Os05t0103200-02 Cyclophilin-like domain containing protein.
AATCCCAATCCACCTGAGCGAGAGAGAGAGAAAGGGTCTCCTCCTCAACATCAACAATGG
CGGTCGCAACCTCCTTCGCCACACTCGCCATCGCGCGGCCGGCGGCGGAGCGGGCCCTCC
tcgcctccaaaaccccctcgccgctcctctccatccgcaccggcaccggcaccgcacgcC
TCCCCTCATCGGCCGTCTTTGGAGGTTTCACTCCTGCGCTTTCCGCTGCTCACAGCCGCG
CGCGCTTCGTCTCCTCCGCCACCGCTGACCCCAAGGAAGTGGACCTCCAGTCCAAAATCA
CAAACAAGGTGTACTTTGACATAAGCATCGGAAACCCTGTTGGGAAGAACGTTGGGAGGG
TCGTTATTGGCCTATACGGGGATGATGTTCCCCAGACCGCAGAGAACTTCCGTGCTCTTT
GCACTGGAGAAAAAGGGTTTGGTTACAAGGGGTCCAGTTTCCACCGTGTCATTAAGGACT
TCATGATTCAGGGAGGAGACTTTGACAAGGGCAACGGTACTGGAGGGAAAAGCATATATG
GCCGGACCTTCAAAGACGAGAACTTCAAATTGGTTCATACTGGACCTGGAGTGGTCAGCA
TGGCCAATGCTGGGCCAAACACCAATGGCAGCCAGTTCTTCATCTGCACTGTCAAGACAC
CTTGGTTGGATGGGAGGCACGTCGTGTTTGGGCAGGTTATTGAAGGCATGGACATCGTTA
AGATGATCGAATCGCAGGAGACTGACAGAGGGGACCGCCCGAAGAAGAAGGTGGTCATCA
GTGAGTGTGGGGAGCTTCCAGTGGTCTAATAGGTGCCAGAGGGCTAATCTTCTTCCCCCG
GAGACTTTGCTGTTTTTGGTTTCATAGTAAGCTGTGAACTTATCGCATGTTCTCCGCGCA
GTCAGAGATCATGCTGAGTTGAGGCCAAGATTTCTAAGTTGAGAAGAATCCTCTATTGTT
CGGCTGGAATAAAACGTTCTTACCTGTCGAGGGTCAGGAAATAATGTTGTGGTTCATGAA
AGATCAAATGTCTGTCTTTTCGTGCATACGCAGACTAAAGTTACTcctttcccaat

CDS

753 bp

>Os05t0103200-02 Cyclophilin-like domain containing protein.
ATGGCGGTCGCAACCTCCTTCGCCACACTCGCCATCGCGCGGCCGGCGGCGGAGCGGGCC
CTCCtcgcctccaaaaccccctcgccgctcctctccatccgcaccggcaccggcaccgca
cgcCTCCCCTCATCGGCCGTCTTTGGAGGTTTCACTCCTGCGCTTTCCGCTGCTCACAGC
CGCGCGCGCTTCGTCTCCTCCGCCACCGCTGACCCCAAGGAAGTGGACCTCCAGTCCAAA
ATCACAAACAAGGTGTACTTTGACATAAGCATCGGAAACCCTGTTGGGAAGAACGTTGGG
AGGGTCGTTATTGGCCTATACGGGGATGATGTTCCCCAGACCGCAGAGAACTTCCGTGCT
CTTTGCACTGGAGAAAAAGGGTTTGGTTACAAGGGGTCCAGTTTCCACCGTGTCATTAAG
GACTTCATGATTCAGGGAGGAGACTTTGACAAGGGCAACGGTACTGGAGGGAAAAGCATA
TATGGCCGGACCTTCAAAGACGAGAACTTCAAATTGGTTCATACTGGACCTGGAGTGGTC
AGCATGGCCAATGCTGGGCCAAACACCAATGGCAGCCAGTTCTTCATCTGCACTGTCAAG
ACACCTTGGTTGGATGGGAGGCACGTCGTGTTTGGGCAGGTTATTGAAGGCATGGACATC
GTTAAGATGATCGAATCGCAGGAGACTGACAGAGGGGACCGCCCGAAGAAGAAGGTGGTC
ATCAGTGAGTGTGGGGAGCTTCCAGTGGTCTAA

Protein

251 aa

>Os05t0103200-02 Cyclophilin-like domain containing protein.
MAVATSFATLAIARPAAERALLASKTPSPLLSIRTGTGTARLPSSAVFGGFTPALSAAHS
RARFVSSATADPKEVDLQSKITNKVYFDISIGNPVGKNVGRVVIGLYGDDVPQTAENFRA
LCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVV
SMANAGPNTNGSQFFICTVKTPWLDGRHVVFGQVIEGMDIVKMIESQETDRGDRPKKKVV
ISECGELPVV*

5'UTR

chr05:185688..185743 (+ strand) : 56 bp

CDS

chr05:185744..185773 (+ strand) : 30 bp

chr05:185873..186061 (+ strand) : 189 bp

chr05:186814..186964 (+ strand) : 151 bp

chr05:187069..187157 (+ strand) : 89 bp

chr05:187736..187790 (+ strand) : 55 bp

chr05:187878..187963 (+ strand) : 86 bp

chr05:188050..188202 (+ strand) : 153 bp

3'UTR

chr05:188203..188469 (+ strand) : 267 bp

FASTA

>Os05t0103200-02 class=Sequence position=chr05:185688..188469 (+ strand)
AATCCCAATC CACCTGAGCG AGAGAGAGAG AAAGGGTCTC CTCCTCAACA TCAACAATGG CGGTCGCAAC CTCCTTCGCC
ACACTCGTAA GCTCACTCAT CCATGGCCTC TGCTCTCCTC TTCTTCCCCA CCGAGCTCTC AATCTTATTA TCGTCGCTCT
TTCTTCTCTT GTGTTTGCAC TGCAGGCCAT CGCGCGGCCG GCGGCGGAGC GGGCCCTCCt cgcctccaaa accccctcgc
cgctcctctc catccgcacc ggcaccggca ccgcacgcCT CCCCTCATCG GCCGTCTTTG GAGGTTTCAC TCCTGCGCTT
TCCGCTGCTC ACAGCCGCGC GCGCTTCGTC TCCTCCGCCA CCGCTGACCC CAAGGTACTG TGTCCCCGGA TCTTCTTCTT
TTATCTGCCC TACATATATC TTTCTATTGC CGCACCGCAT CCATTCTTGT AATCCTGTCT AGTAGTATAT CAGTCAAATT
TACTACTCCA CCTTACTGGA CTATTATTAT GCAATCAGCC TCCGCAATAC CGGCCCCTGT TTGTTGCCTC TTTGGAGGAA
GAGATATTGG GTTAGCACAG ATGACCTCGA CCTTCCAACA CCATTAAATT AAAACTAATA CTAGTAATGC CTTTGTATGT
CAAATTTTGT TATCAGATTT TTAAATCACC AGGTGAAATT TATGCTACCA AAATTGCAGT TTCAGGCTTA TCATCACCAA
TGCTTTATTA TGTATTCACC TGCTCTGATT AATAATTTTA GTTGCCTCGA CCATAGGGTT CTGCTACTTA CAGGTCTTAC
CTTGTATGTG CACCGAATGT AAACACGTTA TTCATCATCA GTGACTGCCT GCAACATTGT GAGGAAACAC GTGTGCCCTT
CTGTACTACT GAAAGCTGGG TTTTCCTTTC CCATGTGCAC TATGCGCTTT CATGTTTTCC TCCACTAGAT GTTAACTTAC
GATATACTAC CTCCTTCCTT TAATATATGA CGTTGGTTAG TTCAATTAAC ATCATACATA AAAGAACAGC GCAAGTATCG
ATTATTCTTA CCCTATGTGG GAGAACTGGA TACCACGCTT CAAATTTATT CTTTCAGTTT TGCTAAACTT CTCCCATACA
TTGCAGGAAG TGGACCTCCA GTCCAAAATC ACAAACAAGG TGTACTTTGA CATAAGCATC GGAAACCCTG TTGGGAAGAA
CGTTGGGAGG GTCGTTATTG GCCTATACGG GGATGATGTT CCCCAGACCG CAGAGAACTT CCGTGCTCTT TGCACTGGTA
CAAAGGGCTT CTTGCTTTTC TTCTCTTCTG TCATCTACTA CTTTACAGGA TTACCCAGAT TTGGTGCATG ATACACATAC
CATTGCCCTT TTCCTTTTCA GGAGAAAAAG GGTTTGGTTA CAAGGGGTCC AGTTTCCACC GTGTCATTAA GGACTTCATG
ATTCAGGGAG GAGACTTTGA CAAGGGCAAC GTATGTCTTC ATTATTTACT TTCTTTATAA TCTACTCCTA TGTTGCACTT
GTTCCTCTGT TTCATCTGAC AAACTCTATT GGAAAAAGTC ACATAGTGTA ACATTACTCA CAACACTGAA TGAGCTCATG
TGTTTGTTTC TATCTATCAC CATTGAGCCA ACTATTTCTC CAAAAAAAAA AAAGTTTGAT TTGTTTTATC AATGTTAGCG
CTTTATGCTG TTTTGGATAG AAAGCTGACC TATATATGTG TTTTGGATCA TTATACAACT TTGTGTTATG CACTTCAGTG
CTTGCCCTAT GGTGTTTTAG ATCATTATAC TGCTTTGCAT CATGTACATT ATGAGTATGA ATTGGTAGTT TGTGATCAGC
ATAATGTGTA TGCAGTGATT ATTGACTTCA TGGCTAGATT ACAAGGAGAT TAGCACCAAA TCCTTTTTCT TTAAATTGAT
GGCCTAAATT AAATCATGCA GCTGCCTGGT TTCATGAATT ATGAATTTTT GACCTAGCCT ACATCAAATC ATTCAGCTTT
CAACTTCTGC ATGTGGATAA AGTAGGTTTC AAAAAATGAA TATTTCAGGG TACTGGAGGG AAAAGCATAT ATGGCCGGAC
CTTCAAAGAC GAGAACTTCA AATGTACGTC TGACAAATGA CCTAATCTGA TCGTTCTTTC TGCTTCTTAT CTTGTGGTTG
TGCTGATTAT ATGTCTTGTA ATGTTTGTAG TGGTTCATAC TGGACCTGGA GTGGTCAGCA TGGCCAATGC TGGGCCAAAC
ACCAATGGCA GCCAGTTCTT CATCTGCACT GTCAAGGTAA CACTGTACTG ATATGTTCAC TGTGTACTAG TGTCGAAACT
CACTCAAAAT TACATTGCGC TGACTGCTAC CTGCGAATGC AGACACCTTG GTTGGATGGG AGGCACGTCG TGTTTGGGCA
GGTTATTGAA GGCATGGACA TCGTTAAGAT GATCGAATCG CAGGAGACTG ACAGAGGGGA CCGCCCGAAG AAGAAGGTGG
TCATCAGTGA GTGTGGGGAG CTTCCAGTGG TCTAATAGGT GCCAGAGGGC TAATCTTCTT CCCCCGGAGA CTTTGCTGTT
TTTGGTTTCA TAGTAAGCTG TGAACTTATC GCATGTTCTC CGCGCAGTCA GAGATCATGC TGAGTTGAGG CCAAGATTTC
TAAGTTGAGA AGAATCCTCT ATTGTTCGGC TGGAATAAAA CGTTCTTACC TGTCGAGGGT CAGGAAATAA TGTTGTGGTT
CATGAAAGAT CAAATGTCTG TCTTTTCGTG CATACGCAGA CTAAAGTTAC Tcctttccca at

Locus: Os05g0103200

Loading...

Locus: Os05g0103200

Loading...