Os05t0104700-01

Locus

Os05g0104700

Description

Leucine-rich repeat (LRR) protein, Inhibitor of fungal polygalacturonase, Defence response

RAP-DB Gene Symbol Synonym(s)

PGIP4, Ospgip4, pgip4, OsPGIP4

RAP-DB Gene Name Synonym(s)

POLYGALACTURONASE-INHIBITING PROTEIN 4, Polygalacturonase-inhibiting protein 4, polygalacturonase inhibiting protein 4

CGSNL Gene Symbol

PGIP4

CGSNL Gene Name

POLYGALACTURONASE-INHIBITING PROTEIN 4

Oryzabase Gene Symbol Synonym(s)

Ospgip4, pgip4, OsPGIP4

Oryzabase Gene Name Synonym(s)

Polygalacturonase-inhibiting protein 4, polygalacturonase inhibiting protein 4

Transcript Evidence

AM180655 (Roma)

AK108676

Protein Evidence

A0AAQ3

Q65XJ2

Literature

PMID: 22362377

PMID: 16906405

Note

Manual Curation

April 18, 2016

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Leucine-rich repeat domain, L domain-like (IPR032675)

Leucine-rich repeat-containing N-terminal, plant-type (IPR013210)

Leucine-rich repeat (IPR001611)

Full-length cDNA

002-149-A03 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0104700-01)

RiceXPro (AK108676)

Others

Oryzabase (7207)

KEGG (Os05t0104700-01)

Transcript

1640 bp

>Os05t0104700-01 Leucine-rich repeat (LRR) protein, Inhibitor of fungal polygalacturonase, Defence response
CAGTGGCTTTTGGGGGTTTTGTGTTGTTGTTTGACCACCCAACCCAACACCAAGAGGTTT
CATTTCACCGTGCGATCGATACATATGGGGATAGACACAAGAGAATTGGAGAAGTCAAAA
AGTTTTTTAAGCATTTGGGATGAATTAGTAATAGAACTTGTGTGCTGAGTTGTTTCAGGG
ACTAAATATCTTGTGTGCTGGATTGTCGTGCACTTGTGTTCAAATAATGCAGGTAGAAGT
AGAACAAGGCACTTGGGGCAGGAGGACACAAATTGTAGAATGCGTCGTTTGATTGTTTTG
TTCAAAGCGGTTGGCGCCAAACTCCTTCCATCTGAACAACTCGCCAATCTGATTACTCCC
TCTCCGTCTACATATATATACCCCCACACCCACATCGTTCAAGATAAGCTGAGACAAAAT
CGATCGGAGGTCGAAATGGTGCGCGCCATCGGGCCCCTGCTCCTGCTCGCCCACGTGCTC
GTGTTCGTGGTGTCCATTGCGGCGGCGGCGGCGCCCGTGCGACGGCCACGCTGCGACGCC
GGCGACCGCGCCGCGCTACTCGCCGTGAAGGCGGCCTTCAACAACGCGTCCTACTTCCAG
TCCTGGACGCCCGACATCGCCTGCTGCCACTGGTACGGCGTCGACTGCGGCGGCGACGAC
TACGACTACGACCCCACCGACGGCGACCGCGTCCTCAGCCTCGCCATCATACGCGATGAC
AACGTCACCGGCGGCATACCAGGCGACGCCATCGCCCGCCTCACCCGCCTCCAGGAGCTC
ATGTTCTTCAAGGTCCCCGGCGTCACCGGCCCCATCCCCGCCGCGCTCGCCACGCTCACC
GCCCTCAGGGAGCTCACCATCTCCCGCACCGCCCTCTCCGGCTCCATCCCTTCCTTCATC
GGCGACAAGTTCACCGCGCTCCAGTCTCTCGACCTCTCCTTCAACTCGCTCACCGGCGCC
ATCCCGGCGAGCCTCGCCAAGCCCCCGAAGCTCATCTCCATCGACCTCAGCCGCAACCAG
CTCACCGGGAGCATCCCGCGGCTGCTGCTGAGCAAGGCCGGGCAGCAAGCGTTCCTGACG
CTGTCACACAACAACCTGTCCGGGAGGATCCCGGCGGCGTTCGGCGCCGTCAACTTCGTG
CAGATCGACCTGTCGCGAAACCAGCTCACCGGCGACGCGTCGATGCTGTTCGGGTCGGGG
AAGAAGGAGCTCGGCAGCGTCTACCTGTCGCGCAACGCGCTGAGCTTCGACATGTCGGAG
CTGCGGCTGCCGGAGCGGCTGAGCTTCCTGGACGTGAGCCACAACGCCATCCGCGGCGGC
ATCCCGGCGCAGGTGGCGAATCTGAGCAACCTGCAGCTGCTCAACGTCAGCTACAACAGG
ATGTGCGGCGAGGTGCCCACCGGCGGCAACATGGCGAGGTTCGACGCCTACTGCTTCCAG
CACAACAAGTGCCTCTGCGGTGCGCCGCTCGCCGCCTGCCATTGATGTTTGATCCAGACC
TTGAAACTGTAACCACTACTGTACTGTAGTAATAATCACTGAGCAATACCAAAAACTATA
GGATAAATTAATGAAGAAGCAACCAGCTAATGCTAATAATTAAGGTCCATTCTTGATGAA
CATGAGTGAAATTTAGTGTC

CDS

1206 bp

>Os05t0104700-01 Leucine-rich repeat (LRR) protein, Inhibitor of fungal polygalacturonase, Defence response
ATGCGTCGTTTGATTGTTTTGTTCAAAGCGGTTGGCGCCAAACTCCTTCCATCTGAACAA
CTCGCCAATCTGATTACTCCCTCTCCGTCTACATATATATACCCCCACACCCACATCGTT
CAAGATAAGCTGAGACAAAATCGATCGGAGGTCGAAATGGTGCGCGCCATCGGGCCCCTG
CTCCTGCTCGCCCACGTGCTCGTGTTCGTGGTGTCCATTGCGGCGGCGGCGGCGCCCGTG
CGACGGCCACGCTGCGACGCCGGCGACCGCGCCGCGCTACTCGCCGTGAAGGCGGCCTTC
AACAACGCGTCCTACTTCCAGTCCTGGACGCCCGACATCGCCTGCTGCCACTGGTACGGC
GTCGACTGCGGCGGCGACGACTACGACTACGACCCCACCGACGGCGACCGCGTCCTCAGC
CTCGCCATCATACGCGATGACAACGTCACCGGCGGCATACCAGGCGACGCCATCGCCCGC
CTCACCCGCCTCCAGGAGCTCATGTTCTTCAAGGTCCCCGGCGTCACCGGCCCCATCCCC
GCCGCGCTCGCCACGCTCACCGCCCTCAGGGAGCTCACCATCTCCCGCACCGCCCTCTCC
GGCTCCATCCCTTCCTTCATCGGCGACAAGTTCACCGCGCTCCAGTCTCTCGACCTCTCC
TTCAACTCGCTCACCGGCGCCATCCCGGCGAGCCTCGCCAAGCCCCCGAAGCTCATCTCC
ATCGACCTCAGCCGCAACCAGCTCACCGGGAGCATCCCGCGGCTGCTGCTGAGCAAGGCC
GGGCAGCAAGCGTTCCTGACGCTGTCACACAACAACCTGTCCGGGAGGATCCCGGCGGCG
TTCGGCGCCGTCAACTTCGTGCAGATCGACCTGTCGCGAAACCAGCTCACCGGCGACGCG
TCGATGCTGTTCGGGTCGGGGAAGAAGGAGCTCGGCAGCGTCTACCTGTCGCGCAACGCG
CTGAGCTTCGACATGTCGGAGCTGCGGCTGCCGGAGCGGCTGAGCTTCCTGGACGTGAGC
CACAACGCCATCCGCGGCGGCATCCCGGCGCAGGTGGCGAATCTGAGCAACCTGCAGCTG
CTCAACGTCAGCTACAACAGGATGTGCGGCGAGGTGCCCACCGGCGGCAACATGGCGAGG
TTCGACGCCTACTGCTTCCAGCACAACAAGTGCCTCTGCGGTGCGCCGCTCGCCGCCTGC
CATTGA

Protein

402 aa

>Os05t0104700-01 Leucine-rich repeat (LRR) protein, Inhibitor of fungal polygalacturonase, Defence response
MRRLIVLFKAVGAKLLPSEQLANLITPSPSTYIYPHTHIVQDKLRQNRSEVEMVRAIGPL
LLLAHVLVFVVSIAAAAAPVRRPRCDAGDRAALLAVKAAFNNASYFQSWTPDIACCHWYG
VDCGGDDYDYDPTDGDRVLSLAIIRDDNVTGGIPGDAIARLTRLQELMFFKVPGVTGPIP
AALATLTALRELTISRTALSGSIPSFIGDKFTALQSLDLSFNSLTGAIPASLAKPPKLIS
IDLSRNQLTGSIPRLLLSKAGQQAFLTLSHNNLSGRIPAAFGAVNFVQIDLSRNQLTGDA
SMLFGSGKKELGSVYLSRNALSFDMSELRLPERLSFLDVSHNAIRGGIPAQVANLSNLQL
LNVSYNRMCGEVPTGGNMARFDAYCFQHNKCLCGAPLAACH*

5'UTR

chr05:256779..257057 (+ strand) : 279 bp

CDS

chr05:257058..258263 (+ strand) : 1206 bp

3'UTR

chr05:258264..258418 (+ strand) : 155 bp

FASTA

>Os05t0104700-01 class=Sequence position=chr05:256779..258418 (+ strand)
CAGTGGCTTT TGGGGGTTTT GTGTTGTTGT TTGACCACCC AACCCAACAC CAAGAGGTTT CATTTCACCG TGCGATCGAT
ACATATGGGG ATAGACACAA GAGAATTGGA GAAGTCAAAA AGTTTTTTAA GCATTTGGGA TGAATTAGTA ATAGAACTTG
TGTGCTGAGT TGTTTCAGGG ACTAAATATC TTGTGTGCTG GATTGTCGTG CACTTGTGTT CAAATAATGC AGGTAGAAGT
AGAACAAGGC ACTTGGGGCA GGAGGACACA AATTGTAGAA TGCGTCGTTT GATTGTTTTG TTCAAAGCGG TTGGCGCCAA
ACTCCTTCCA TCTGAACAAC TCGCCAATCT GATTACTCCC TCTCCGTCTA CATATATATA CCCCCACACC CACATCGTTC
AAGATAAGCT GAGACAAAAT CGATCGGAGG TCGAAATGGT GCGCGCCATC GGGCCCCTGC TCCTGCTCGC CCACGTGCTC
GTGTTCGTGG TGTCCATTGC GGCGGCGGCG GCGCCCGTGC GACGGCCACG CTGCGACGCC GGCGACCGCG CCGCGCTACT
CGCCGTGAAG GCGGCCTTCA ACAACGCGTC CTACTTCCAG TCCTGGACGC CCGACATCGC CTGCTGCCAC TGGTACGGCG
TCGACTGCGG CGGCGACGAC TACGACTACG ACCCCACCGA CGGCGACCGC GTCCTCAGCC TCGCCATCAT ACGCGATGAC
AACGTCACCG GCGGCATACC AGGCGACGCC ATCGCCCGCC TCACCCGCCT CCAGGAGCTC ATGTTCTTCA AGGTCCCCGG
CGTCACCGGC CCCATCCCCG CCGCGCTCGC CACGCTCACC GCCCTCAGGG AGCTCACCAT CTCCCGCACC GCCCTCTCCG
GCTCCATCCC TTCCTTCATC GGCGACAAGT TCACCGCGCT CCAGTCTCTC GACCTCTCCT TCAACTCGCT CACCGGCGCC
ATCCCGGCGA GCCTCGCCAA GCCCCCGAAG CTCATCTCCA TCGACCTCAG CCGCAACCAG CTCACCGGGA GCATCCCGCG
GCTGCTGCTG AGCAAGGCCG GGCAGCAAGC GTTCCTGACG CTGTCACACA ACAACCTGTC CGGGAGGATC CCGGCGGCGT
TCGGCGCCGT CAACTTCGTG CAGATCGACC TGTCGCGAAA CCAGCTCACC GGCGACGCGT CGATGCTGTT CGGGTCGGGG
AAGAAGGAGC TCGGCAGCGT CTACCTGTCG CGCAACGCGC TGAGCTTCGA CATGTCGGAG CTGCGGCTGC CGGAGCGGCT
GAGCTTCCTG GACGTGAGCC ACAACGCCAT CCGCGGCGGC ATCCCGGCGC AGGTGGCGAA TCTGAGCAAC CTGCAGCTGC
TCAACGTCAG CTACAACAGG ATGTGCGGCG AGGTGCCCAC CGGCGGCAAC ATGGCGAGGT TCGACGCCTA CTGCTTCCAG
CACAACAAGT GCCTCTGCGG TGCGCCGCTC GCCGCCTGCC ATTGATGTTT GATCCAGACC TTGAAACTGT AACCACTACT
GTACTGTAGT AATAATCACT GAGCAATACC AAAAACTATA GGATAAATTA ATGAAGAAGC AACCAGCTAA TGCTAATAAT
TAAGGTCCAT TCTTGATGAA CATGAGTGAA ATTTAGTGTC 

Locus: Os05g0104700

Loading...

Locus: Os05g0104700

Loading...