Os05t0104900-01

Locus

Os05g0104900

Description

Similar to STIP1 homology and U box-containing protein 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPUB66

Oryzabase Gene Name Synonym(s)

plant U-box-containing protein 66, U-box protein 66

Transcript Evidence

AK069824 (DDBJ, Best hit)

Protein Evidence

NP_001149248.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: binding (GO:0005488)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Tetratricopeptide-like helical (IPR011990)

Tetratricopeptide repeat-containing (IPR013026)

Tetratricopeptide repeat (IPR019734)

Full-length cDNA

J023026A06 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0104900-01)

Others

Oryzabase (17857)

Transcript

1505 bp

>Os05t0104900-01 Similar to STIP1 homology and U box-containing protein 1.
GTGTTCAAACCGAAGCAAAACGGGAAGGAAAACCAACCAAATCCAAGAAGCTGCTTCTAT
GGCGACGGCGGCGGATGGCGTGGCGGTAGCGAGGCAAGCGGAGCTCCGGCGGATCGAGGG
CAACTCCTGCTTCAACAAGGCCCGCCTCGGCGCCGCCATCGACTGCTACACCGAGGCTAT
CGCTCTTTGCCCCGACGTCGCCGTCTACTGGCTCAACCGGGGCCTCTGCCATTTCAAGCG
CAAGGAATGGGCTAAGGTCGAAGAGGATAGCAGGAGAGCTCTTGCCCTTGATGACACTCT
GGTCAAGGTAACATCATCTCAATGTCCCTTGTTCATACATAAATCAAGTGATTGTTACAG
GTCTTCAACTTTGGTCCAGGGTCACTATTTGCTGGGATGTGCCATGCTTGAGAAGGAACA
ATGTGCTCTTGCTATCAAGGAATTCAACAAGGCTTTGGATCTTCTTAAGTCTTCGAATTT
GGGGGACAAAATGGCGGAGGACATTTGGCAGGTTCTTGCGAAGGCAAAATACCAAGATTG
GGAAATACACTCCACTAAGAGAGTTTGGAAGATGCAAAGTTTAAAGTATGTTATGCATGA
AAAATAATTGCAATAATAATGTTCCATAATTGTGTTGCAGATTAACTGTAGTGTGAATCT
TGGGTATTGGTGGCCAATTTACTCCTATAACAACCTGGACACTCCCTTTATTATCTAAAA
TTTATGATGCTTTAAACTTTCTAACACCACTGTGTCACATGGACAATTAGGGAAGCATGT
GAAAATGCTTTGCAGGAGCACCACTTTCTTAGTGGCACACTTGTGGGAGATGGCTCAACC
AATGAGTATACAGACCAACTGAAATTGTTATCAGAAGTCTTCACCAAAGCTACAATCGAC
GATACACCAACAgatgtaatattattatctatgttatctcatgttcaacatctttgtGCT
AGCATATTTTTTTTCTCTGTGATCTTAGGCTGTTGCTACCTGAAAATCTAGGTGCCTGAC
TACCTTTGCTGCCAAATAACCTTTGAGATTTTTAGAGATCCAGTGATCACACCCAGTGGT
ATAACGTATGAGAGGTCCATAATCCTTGAACATCTTTGCAAGGTGGGCAATTTCGACCCG
GTGACACGAGAGCCTCTGAAAGAGCATCAATTGGTTCCTAACCTGGCTATAAAGGAAGCA
GTCCAAGCCTACCTCAAGAATCACAGTTGGGCCTACAAGTTGAACTGATGATGTTGCTCT
GTAGTTGCTTAGTGCTAACAACAGGTGTTGATAAAATGTTGGGTTGTCAAGGGGGAATTC
TTTGCTTTTCTGATGTAATGTATAAGCAAGTTCATTCGTGCCCTCATGGAATTGATTGAT
TCTTGGGCAACTTCTGACGAACCTTGGACAATTGTACATAAAACATCATAGCAGAACCTT
GGACGGTTTCAGACATACCGTGCCAAAATGACAATTCTCAGTGACAAATTATTCTTTTGT
TCGGT

CDS

549 bp

>Os05t0104900-01 Similar to STIP1 homology and U box-containing protein 1.
ATGGCGACGGCGGCGGATGGCGTGGCGGTAGCGAGGCAAGCGGAGCTCCGGCGGATCGAG
GGCAACTCCTGCTTCAACAAGGCCCGCCTCGGCGCCGCCATCGACTGCTACACCGAGGCT
ATCGCTCTTTGCCCCGACGTCGCCGTCTACTGGCTCAACCGGGGCCTCTGCCATTTCAAG
CGCAAGGAATGGGCTAAGGTCGAAGAGGATAGCAGGAGAGCTCTTGCCCTTGATGACACT
CTGGTCAAGGTAACATCATCTCAATGTCCCTTGTTCATACATAAATCAAGTGATTGTTAC
AGGTCTTCAACTTTGGTCCAGGGTCACTATTTGCTGGGATGTGCCATGCTTGAGAAGGAA
CAATGTGCTCTTGCTATCAAGGAATTCAACAAGGCTTTGGATCTTCTTAAGTCTTCGAAT
TTGGGGGACAAAATGGCGGAGGACATTTGGCAGGTTCTTGCGAAGGCAAAATACCAAGAT
TGGGAAATACACTCCACTAAGAGAGTTTGGAAGATGCAAAGTTTAAAGTATGTTATGCAT
GAAAAATAA

Protein

183 aa

>Os05t0104900-01 Similar to STIP1 homology and U box-containing protein 1.
MATAADGVAVARQAELRRIEGNSCFNKARLGAAIDCYTEAIALCPDVAVYWLNRGLCHFK
RKEWAKVEEDSRRALALDDTLVKVTSSQCPLFIHKSSDCYRSSTLVQGHYLLGCAMLEKE
QCALAIKEFNKALDLLKSSNLGDKMAEDIWQVLAKAKYQDWEIHSTKRVWKMQSLKYVMH
EK*

5'UTR

chr05:266266..266323 (- strand) : 58 bp

CDS

chr05:266147..266265 (- strand) : 119 bp

chr05:265977..266042 (- strand) : 66 bp

chr05:265686..265893 (- strand) : 208 bp

chr05:265072..265227 (- strand) : 156 bp

3'UTR

chr05:264557..265071 (- strand) : 515 bp

chr05:263744..264126 (- strand) : 383 bp

FASTA

>Os05t0104900-01 class=Sequence position=chr05:263744..266323 (- strand)
GTGTTCAAAC CGAAGCAAAA CGGGAAGGAA AACCAACCAA ATCCAAGAAG CTGCTTCTAT GGCGACGGCG GCGGATGGCG
TGGCGGTAGC GAGGCAAGCG GAGCTCCGGC GGATCGAGGG CAACTCCTGC TTCAACAAGG CCCGCCTCGG CGCCGCCATC
GACTGCTACA CCGAGGCAAC CTCCCTCTTT CCCCTCCCCC TCCCCAATCC CTAGCTCCCC CTTTCCCTTT CCTTTTTTCA
ATCTTTGGCA ACCGATATGA TTAACTCCAC GATCTCCAGG CTATCGCTCT TTGCCCCGAC GTCGCCGTCT ACTGGCTCAA
CCGGGGCCTC TGCCATTTCA AGCGCAAGTA TTTCTCTCCC TTGTTTCTTC CCCTCCCTCA CTATCTCTTT CTTGGGGGAA
AAAACTTGAT TCTTTTTTAA TGTGATACAG GGAATGGGCT AAGGTCGAAG AGGATAGCAG GAGAGCTCTT GCCCTTGATG
ACACTCTGGT CAAGGTAACA TCATCTCAAT GTCCCTTGTT CATACATAAA TCAAGTGATT GTTACAGGTC TTCAACTTTG
GTCCAGGGTC ACTATTTGCT GGGATGTGCC ATGCTTGAGA AGGAACAATG TGCTCTTGCT ATCAAGGAAT TCAACAAGGT
TTGTTATTAT ACTTCTATGG CCCTTGTAAG TTTGCTTCAG CTTCTTCTGA ATCATATCCT GAGCTCTTCA CCATGTTATT
GTTTAGGACA AATCTTAACA TAAACAAAGA ATTTTGGAAT TGAGAAATAG CTTAAATGAC TTTGTTTCCC TTCATTTTAC
TACATTGGAA AGGATGGCTC ATTTATTTGT GAAAGGGGTA GAATTTTTTT GGCTGGGGCA ATCATGGAAG AAAAGATGAA
AAAAAAAAGC CTAAAGTGAC TTGCATTTAC AAAAGGCTTG AGAAGACTAA TACTACTTAC ATTTGGAATC GAAGGGGATA
TTTACTAATG AATGCTAATG TTGTGTCTTC ACGCACCTAC ATATTGATAT TTTGTTGCTA CATTCATGTT GAAATGGGAT
GTTGATCTCT TGCCATGCTA TTGCTAATAC CATGCTTATG TTATCATGTA AAACAGGCTT TGGATCTTCT TAAGTCTTCG
AATTTGGGGG ACAAAATGGC GGAGGACATT TGGCAGGTTC TTGCGAAGGC AAAATACCAA GATTGGGAAA TACACTCCAC
TAAGAGAGTT TGGAAGATGC AAAGTTTAAA GTATGTTATG CATGAAAAAT AATTGCAATA ATAATGTTCC ATAATTGTGT
TGCAGATTAA CTGTAGTGTG AATCTTGGGT ATTGGTGGCC AATTTACTCC TATAACAACC TGGACACTCC CTTTATTATC
TAAAATTTAT GATGCTTTAA ACTTTCTAAC ACCACTGTGT CACATGGACA ATTAGGGAAG CATGTGAAAA TGCTTTGCAG
GAGCACCACT TTCTTAGTGG CACACTTGTG GGAGATGGCT CAACCAATGA GTATACAGAC CAACTGAAAT TGTTATCAGA
AGTCTTCACC AAAGCTACAA TCGACGATAC ACCAACAgat gtaatattat tatctatgtt atctcatgtt caacatcttt
gtGCTAGCAT ATTTTTTTTC TCTGTGATCT TAGGCTGTTG CTACCTGAAA ATCTAGGTGC CTGACTACCT TTGCTGCCAA
ATAACCTTTG AGATTTTTAG AGATCCAGTG ATCACACCCA GTGGTATAAC GTATGAGAGG TCCATAATCC TTGAACATCT
TTGCAAGGTA CACCTCCCTT GCTAATTTGC TATCTGTTTT TCAGAAGGTT TTTGGCTCTG CATATCTTTA GATGTTGTTG
CTAATATTTC ACTAGAAGGA CCATGTATTA GCTGGCTACA TCTACAAATA ATGTCTCCAA CAGATGAAAT ACTTGATTGT
ATAATTAAAA AGAATAAGTC AAAATCGAAC TAGTTTTTTT TTTTGAAAGG AACACAGCAG GGAGGCCCAA AAAAATCGAA
CTAGTGGAAT ATTTGAATCA GCACAATGCT GCAATATTTA AATATGAAAC TGCTGTAGTT CATATATTGG GTGGATTATG
TGTCAATGAT Ctaatttaag ctatagtagg attcaatcta aacacaaact ataatttaaa ttgaaattaa atgAGAATAA
TGTGCTCAGT CACTGCAATC TTCCTTTTGG GTTTTAGGTG GGCAATTTCG ACCCGGTGAC ACGAGAGCCT CTGAAAGAGC
ATCAATTGGT TCCTAACCTG GCTATAAAGG AAGCAGTCCA AGCCTACCTC AAGAATCACA GTTGGGCCTA CAAGTTGAAC
TGATGATGTT GCTCTGTAGT TGCTTAGTGC TAACAACAGG TGTTGATAAA ATGTTGGGTT GTCAAGGGGG AATTCTTTGC
TTTTCTGATG TAATGTATAA GCAAGTTCAT TCGTGCCCTC ATGGAATTGA TTGATTCTTG GGCAACTTCT GACGAACCTT
GGACAATTGT ACATAAAACA TCATAGCAGA ACCTTGGACG GTTTCAGACA TACCGTGCCA AAATGACAAT TCTCAGTGAC
AAATTATTCT TTTGTTCGGT 

Locus: Os05g0104900

Loading...

Locus: Os05g0104900

Loading...