Os05t0107900-01

Locus

Os05g0107900

Description

Similar to Protein DEHYDRATION-INDUCED 19 homolog 6.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDi19-6

Oryzabase Gene Name Synonym(s)

drought-induced 19-6

Transcript Evidence

AK121060 (DDBJ, Best hit)

Protein Evidence

Q7XBA5 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Drought induced 19/ RING finger protein 114 (IPR008598)

Full-length cDNA

J023057C17 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0107900-01)

RiceXPro (AK121060)

Others

Oryzabase (18581)

KEGG (Os05t0107900-01)

Transcript

757 bp

>Os05t0107900-01 Similar to Protein DEHYDRATION-INDUCED 19 homolog 6.
TTGGTCACTTTGATCTCTTCTTGGTTGGTTGTTGAATGTTCTTTGGCCTGCCTGAGATGA
TGAGTGGTGGGAGTACATCCCTTGCCCCTTCTGCTACATTGAGGTGGAGGTTCATTTCCT
TTGTGACCATCTCCAGGAGGAGCATTGCTTTGACATGAAAAATGCTGTGTGTCCAATCTG
CGCCGACAACCTTGACAAGGACACTGATGAACATTTCAGGGTTCAGCACTCACATCTACT
CAAGAGGAGGAAGTCTTCTTCTTTTTCTTGCAAGCCAAGCTCAGCAGCAGCTGACAAGGG
ATCATATGAAGAGGACTCCTACTTTGAAGCACCCTCACACTGCATGGGCAGGCCGGCTCC
TGATTCCTCTCCTGACCCTCTTCTCTCCCAGTTCATCTGCTGCAGCCTCGCTCCTCCGGT
CGATTCGCCGCGCCGCAGCGAAGCCGATGCCGAGGGCCATGGTTCATCTTCCTCAGATGA
TCAAAAAAGGAGAGAGCAGGGTGTGATGGATGATGCATCAAAGGAGGAGCTTGAGGAGAG
GTTGCAGAGAATCGAGTTCGTGAAGCAGATGCTGATGACAACAATTGCTTATTAGAAGAC
TGTTTCTCTAGGGTTCATTTCGGCAGTTTGGGTAGGCTTTTCAGGATTTGGGACAAGTGC
AGAATGATGTGCCATTTAATTTATGCTGACCTTCGGCACATGTATACCTACAATGTTTGG
ATATCTATATAATCATCAATCGTAATCCTATCAATTT

CDS

540 bp

>Os05t0107900-01 Similar to Protein DEHYDRATION-INDUCED 19 homolog 6.
GATGATGAGTGGTGGGAGTACATCCCTTGCCCCTTCTGCTACATTGAGGTGGAGGTTCAT
TTCCTTTGTGACCATCTCCAGGAGGAGCATTGCTTTGACATGAAAAATGCTGTGTGTCCA
ATCTGCGCCGACAACCTTGACAAGGACACTGATGAACATTTCAGGGTTCAGCACTCACAT
CTACTCAAGAGGAGGAAGTCTTCTTCTTTTTCTTGCAAGCCAAGCTCAGCAGCAGCTGAC
AAGGGATCATATGAAGAGGACTCCTACTTTGAAGCACCCTCACACTGCATGGGCAGGCCG
GCTCCTGATTCCTCTCCTGACCCTCTTCTCTCCCAGTTCATCTGCTGCAGCCTCGCTCCT
CCGGTCGATTCGCCGCGCCGCAGCGAAGCCGATGCCGAGGGCCATGGTTCATCTTCCTCA
GATGATCAAAAAAGGAGAGAGCAGGGTGTGATGGATGATGCATCAAAGGAGGAGCTTGAG
GAGAGGTTGCAGAGAATCGAGTTCGTGAAGCAGATGCTGATGACAACAATTGCTTATTAG

Protein

180 aa

>Os05t0107900-01 Similar to Protein DEHYDRATION-INDUCED 19 homolog 6.
DDEWWEYIPCPFCYIEVEVHFLCDHLQEEHCFDMKNAVCPICADNLDKDTDEHFRVQHSH
LLKRRKSSSFSCKPSSAAADKGSYEEDSYFEAPSHCMGRPAPDSSPDPLLSQFICCSLAP
PVDSPRRSEADAEGHGSSSSDDQKRREQGVMDDASKEELEERLQRIEFVKQMLMTTIAY*

5'UTR

chr05:446567..446619 (+ strand) : 53 bp

chr05:447316..447317 (+ strand) : 2 bp

CDS

chr05:447318..447428 (+ strand) : 111 bp

chr05:447840..447917 (+ strand) : 78 bp

chr05:448076..448320 (+ strand) : 245 bp

chr05:448428..448533 (+ strand) : 106 bp

3'UTR

chr05:448534..448695 (+ strand) : 162 bp

FASTA

>Os05t0107900-01 class=Sequence position=chr05:446567..448695 (+ strand)
TTGGTCACTT TGATCTCTTC TTGGTTGGTT GTTGAATGTT CTTTGGCCTG CCTGTATGTC TTGTTAGGTG ATCTTTGTTT
TGTGCTGTGC CAAGGAAATT TTGGTTCTTG GTGGATCCTT TGAGCTCCTC GAGTGGTTCT TATGGTTGGG TATTCAGTTC
AGTTCAGTTC TCGGAGTGTT TTCTCTTGTC TGTGTTTCCT CTTTTTTTTT CCATGTTTAC TGATTTCTTG ACAATGGCCT
CCTGTCTTGC ATATGTTTGA TCTCTTATCA TCAAAAGAAT CAGCAATTTT TGGGAGGTTT TTGTGGCGAG AATTTCTCCT
GGTGTTTGAC ATCTGTTCCA TTGGAACTAA TTCAGGATTC CTTTCAGAGA AAAGGAGAAT TAATTCAGGA TCATTATATG
CATTTTCATG TGGTGTTTAC CGGTTTAATC TCTTTTGTGA ATGTAAATCG AAAGGTTCGC AGTGCGGATC ACATGAGAGT
GTGTGTGAGA GAGGTATTGT TGGTGTTTAG TGTGAACTTA CTACCATTGT CAAATAACCA ACACAATGTC ACACAAAAAG
TTCAGAAAAG GAACCTTCAC TGTTGCTTGG AATTTATATG CATTGTGAGC TTCATTTTTT TTTCCTAAAA AAACATATTG
CCCCCCTTTT CTTTTGTTTG TTTCAGATGT ACTCTGAAAT TGCAGGTGTG GGAGAAAGAA CTGCAATTGT GAATTTACCG
GTTAAAAGTT TTCTCCTTTT TTTTTTCAGG AGATGATGAG TGGTGGGAGT ACATCCCTTG CCCCTTCTGC TACATTGAGG
TGGAGGTTCA TTTCCTTTGT GACCATCTCC AGGAGGAGCA TTGCTTTGAC ATGAAAAATG CTGTAAGAAG AACGCACCGC
ACCTGCTATC TATTCCTTTT CTTCTCTTCT TGCTGCAAAT GCATTCTCAT GTGCCTGTCG ATGCATCTCT GAATTTTGAT
GAATCAAGCT TCAGTGTTAA CTTCAGTAAA AATTCACAAG GAAAAACTTT AACCTTGTGC CAGTCTGTAC CATAATCCAT
TGATGAGACT GCACAGTGTA GTAGGAGTAG TAAACTACAC ACAAGTTGTT CACTGTAGTT GTGAACTTGT AAATAGTCCT
CACCTCTGTT CAGTCTAATG GTGATTGGTG AACAGTTCAC TAAGCAAAAT ATTCTCCAAA GATTTACTGT AGATTGTGAT
TCTTCTCAGA TTGGTGATAC TGTTGGGATC AGTTCCTCTA TGATGATGAT CTGATCGAAT GACTTTCCTC CAGGTGTGTC
CAATCTGCGC CGACAACCTT GACAAGGACA CTGATGAACA TTTCAGGGTT CAGCACTCAC ATCTACTCAA GGTAGAGTAC
TCAATTTCTC ATTGCTTTCA CAGTGATTTC ACTGCTACTA GTGCCATGAT CAGGCATTGC AATTTGCAAA CCACATTGGA
GCTCCTGTAG ATTAAATCTA CTACTGGTAG TAGCTCATTG CCATTTGGTA TTTTGATCAT GATCCACAGA GGAGGAAGTC
TTCTTCTTTT TCTTGCAAGC CAAGCTCAGC AGCAGCTGAC AAGGGATCAT ATGAAGAGGA CTCCTACTTT GAAGCACCCT
CACACTGCAT GGGCAGGCCG GCTCCTGATT CCTCTCCTGA CCCTCTTCTC TCCCAGTTCA TCTGCTGCAG CCTCGCTCCT
CCGGTCGATT CGCCGCGCCG CAGCGAAGCC GATGCCGAGG GCCATGGTTC ATCTTCCTCA GATGATCAAA AAAGGTAAGA
ATTGTGCAGT TGGTGCTGTT GGAGCAGCCT GAAATTTGGT AACAATTGTG CTGAATCTGA ACAATGCTGA CTGATCCAAA
TGCAATCTTT GATGCTTGCA GGAGAGAGCA GGGTGTGATG GATGATGCAT CAAAGGAGGA GCTTGAGGAG AGGTTGCAGA
GAATCGAGTT CGTGAAGCAG ATGCTGATGA CAACAATTGC TTATTAGAAG ACTGTTTCTC TAGGGTTCAT TTCGGCAGTT
TGGGTAGGCT TTTCAGGATT TGGGACAAGT GCAGAATGAT GTGCCATTTA ATTTATGCTG ACCTTCGGCA CATGTATACC
TACAATGTTT GGATATCTAT ATAATCATCA ATCGTAATCC TATCAATTT

Locus: Os05g0107900

Loading...

Locus: Os05g0107900

Loading...