Os05t0108050-00

Locus

Os05g0108050

Description

Hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

tplb0059c21 (Wheat FLcDNA)

Protein Evidence

longestORF

Literature

Note

Manual Curation

Expression Databases

TENOR (Os05t0108050-00)

Transcript

1492 bp

>Os05t0108050-00 Hypothetical protein.
GCAATTTTGCCAAATGGCATGGTGAGTAATCATAAATATCCCTTTGTGATTTGTTCCTCC
AGCTCAGCAAAACTCCAAGCATCATTGACTGAAAAGCTGTGTACACGAATATCCGAATAA
TAAGCAGACCTTCCGAGCGCTTTCCCCAAATCTGCACAGAGGGATCGAATATATGTTCCT
TTTGAGCAAATAACTCGAAATATCAGATTTTAATACCTGTCTTCTAAACTGCGCTCAATA
TCAAACTGGTGTATTGATATTCGCCTTGGTGAAAGCTCTACTGTTTCACCCCTCCTTGCT
TTGTCATACATTTTTTCACCACCAACCTTAATGGCAGAAAACATTGGAGGAACTTGCCAT
ATCTCGCCCCTGAATGATGCTGCTACCTTTCTAATATCTTCATCTTTAATGTGTTCCCAT
GAATACAAGATACATACTGGTGAATCTGCATCCCAGGTTGATGTAGCTTCTCCAAGTCGA
AAAACACCACTATAGCCTTTAACCATTCCTTGATATCTATCAACAACTTTGGTTGCTTTA
CCCACACAAACAATCAACAGTCCAGTTGCCATTGGATCCAGAGTACCAGCATGCCCGACC
TGACATCATATATTCAATAAACATACCGTTCATCAAGAGAGGATAAAGAGGCATCACCTT
TGGGCTTGTCGATGAGCACGACTGTCCCGGTCGGGCCGTTCCACCTCGGCGGCAGCTCCG
TTCTCCTGCTCGCGAGATGCGGCTGCGGCCATTCATCCGCCTCGTGCCTCACCTGCGGAG
GCTCCTTCTTCTTCGCCTTCATCACGTTAGCCTCGCCATGGCCAGGGCCTTTCTTCAATG
ACCTGAAGAAATCCTCCACCTTCCTCTCCAACACCTCCCCTCGATCCTCGCCATCCTTCT
TCTTCTTCACCTCCGCCTCCTTGTTGTTATCGTCGTCGTCGAAGAAGACGAGGCCCTTGT
CGGCGGCGTCGGAGGAAGGCGGCGAGGCGTCGGCGGGGACGAAGGCGTTGTCGAGGGATT
GGTCCGGGAAGTACTTCTTCTCGAGGCGGTAGAGCATGCGGTAGTGCTTGTCCTTCTCCC
AGGGTAGCGCGAACGCGTCGTGGAAGTAGAGCGCCTCCTCCCGCGCGTGCAGCCGCGGGA
AGTCCACCACCTCCGGCTTCAGCTCCACGAACTCCGACGAGGAGGAGGAGGAGGGCTTGG
CGGTGGTGGCGTCGGGGTCGGGGAGGAGGCGGCTGCGGCGCTTCCGGAGGTACCGGCGCT
TGGCGCGGTCGAGGTGGTCGTCGGTGGGCCGGGTGTGGCGGTCATCGGCGGCGGAGGATT
TGGGCGGATTGGGGTAGGAGGGGCGGTAGAGGAGGAGGTCGTAGTAGAGCGGGTAGGGGG
TGGCCGTCAGCGAGAGGAAGCGTCGGGGGAGGCGGAGCGGCGGCGGCGAGGAGGAGGAGG
AGAGCAGCTGCGCCGCCGCCGTGGCTCGCGCTCCGCCGCCGGTGCGAAGCAT

CDS

381 bp

>Os05t0108050-00 Hypothetical protein.
ATGAGCACGACTGTCCCGGTCGGGCCGTTCCACCTCGGCGGCAGCTCCGTTCTCCTGCTC
GCGAGATGCGGCTGCGGCCATTCATCCGCCTCGTGCCTCACCTGCGGAGGCTCCTTCTTC
TTCGCCTTCATCACGTTAGCCTCGCCATGGCCAGGGCCTTTCTTCAATGACCTGAAGAAA
TCCTCCACCTTCCTCTCCAACACCTCCCCTCGATCCTCGCCATCCTTCTTCTTCTTCACC
TCCGCCTCCTTGTTGTTATCGTCGTCGTCGAAGAAGACGAGGCCCTTGTCGGCGGCGTCG
GAGGAAGGCGGCGAGGCGTCGGCGGGGACGAAGGCGTTGTCGAGGGATTGGTCCGGGAAG
TACTTCTTCTCGAGGCGGTAG

Protein

127 aa

>Os05t0108050-00 Hypothetical protein.
MSTTVPVGPFHLGGSSVLLLARCGCGHSSASCLTCGGSFFFAFITLASPWPGPFFNDLKK
SSTFLSNTSPRSSPSFFFFTSASLLLSSSSKKTRPLSAASEEGGEASAGTKALSRDWSGK
YFFSRR*

5'UTR

chr05:449168..449262 (+ strand) : 95 bp

chr05:449966..450081 (+ strand) : 116 bp

chr05:450197..450309 (+ strand) : 113 bp

chr05:450810..450906 (+ strand) : 97 bp

chr05:451243..451337 (+ strand) : 95 bp

chr05:451527..451634 (+ strand) : 108 bp

chr05:452288..452334 (+ strand) : 47 bp

CDS

chr05:452335..452715 (+ strand) : 381 bp

3'UTR

chr05:452716..453155 (+ strand) : 440 bp

FASTA

>Os05t0108050-00 class=Sequence position=chr05:449168..453155 (+ strand)
GCAATTTTGC CAAATGGCAT GGTGAGTAAT CATAAATATC CCTTTGTGAT TTGTTCCTCC AGCTCAGCAA AACTCCAAGC
ATCATTGACT GAAAAGTCGC CTGCGAAGTA AAACTAAAAT ATGATGGCTG ATCTGGACCA AAGGAACTTA TGTCCCTTAA
AAATATGTAT GAATAATTTT GATATACAAT TCACTGTTGA GGAACGAGAC GTTCAAATTA CAGTAAAATT AATTGATCAT
CATGCATAAC CAGTCAAAAT TCACAAGACG AAAACTTACC AATTGAGTCT CTCCGCAAGG CAGTTAAATG AGCACAGCTG
CAGGCAAACA TGGATATCTG ATTTAGTCAC CACGATGTAA AGGAGATGTA AAGTTGGAAA CGTCCAACAA CAGCAACTCA
AATGGAAAGA AAGGACAAGT CTCGGACGTC AACTGAAAGA TAAGTGGATC TTTAACTACA TGCCCTAAAA ATAAGAAAAG
AAGGCGGCAT TTGGTTATTA GATCATGATG GAACCAACAC CAGAAACTAG CCGACCACAA TGCAATAGAT AAATTCAAAA
TATCTTCCCC TGGTTCAATG TCATGCAAAT ACTTGTAGCA AATGAAATTC TATTATCTTC AGAGTGGATA AAGTGATTTT
CTAGCCTAAT ATGATGATAT CACAATCTTA GAAACCTAAA AAGGAGATGG GTTATTCTGC ACTTTTAAAC AATTGAACTA
CTATGCATAG ATCAACTCAT TCAATGCAGA ACCGCCTGAA GCAGAAAGAC CAAAAAAAAA AAAACAATGA AAACAAAGGC
TGTGTACACG AATATCCGAA TAATAAGCAG ACCTTCCGAG CGCTTTCCCC AAATCTGCAC AGAGGGATCG AATATATGTT
CCTTTTGAGC AAATAACTCG AAATATCAGA TTTTGTCTGG AAATACACAA ACAAAAATCA TGTCAGGTGG AGTCTCGAAC
AGTATGAACC AAGCGTATGT AGATCTGTGC TCAAGGAAGT CAAAGGTAAA AAAGGGGGAA ACTAGGAAGA ATACCTGTCT
TCTAAACTGC GCTCAATATC AAACTGGTGT ATTGATATTC GCCTTGGTGA AAGCTCTACT GTTTCACCCC TCCTTGCTTT
GTCATACATT TTTTCACCAC CAACCTGATA TCTATTTAGT TAATTGCAGT TCTGTGGTTG ATCAACACAA GTTGGAGGAT
TTTTTTTTCC TCCCAATAGA TTGATAACGA TTAAAGACAC TATGTATTCT TTAAGCTACA CAGTTAACTA CCATTCTACC
AACTACTACG CAGCATCTTC TTGTGAGACC TAAAGTATAA CTATTAACAA ATTCTGCATT TTGCATAAGA TAATAACTAA
TGTACAAATG GCCAACCAGG GACAGTCAAA CCTGACTGCA CCTATGCCAT TAACAAGTTG AATAACAACA GCAATCACAA
ATTCACAGTA CAGCAACAGA TGTTGAGAAC TTGAGATAGT GCAACCGGCA TATAATTCAA ATGGTTTGTA GTCTGTGTTA
TCAAGCATAA CTGTATAGGA GATACTGCGA GGTTAGCAAA TCCCACAGAA GAATTCTAGC AACAACTTCT CTTTATCTAC
AAGGAAACAA TAACAGGTTT AGTGTAATAT AGGAGATAGT GTACCTTAAT GGCAGAAAAC ATTGGAGGAA CTTGCCATAT
CTCGCCCCTG AATGATGCTG CTACCTTTCT AATATCTTCA TCTTTAATGT GTTCCCATGG TTCTCTCTGG ATAACCTGAT
GATACATAGA TGGTTAGGCA TAACCATCAT GTAAACAGAA AAAAAGCATA ATTTGAACCA AAGTCAATAT AGATGTAGAA
AGTTTAACAA GGATTAAATG TAGCAAAAAA ACCAGATTTA ACTTAATTGT TCCCCAATAA AAATCTTCCA CACTTCAAGT
TCTATTAATC AAGATTGGCC AAACCAACAC AATTGTATTA ATTGTGTACT TAATAAGTTG TCTTACTGTA TTAATTTCTC
ACGTGTCATA CAAGTTAAAA GTAAACCCGA TTTGAAGTTC CTAATAGAAA TATATGCAGT AGGTCATTTT ATCAGAATAC
AAGATACATA CTGGTGAATC TGCATCCCAG GTTGATGTAG CTTCTCCAAG TCGAAAAACA CCACTATAGC CTTTAACCAT
TCCTTGATAT CTTTAAAAGC ATATGGACAT TCACTCAGGA AAGTTTTCAA GAATGCTAGA ACAGGAGGTT TACTGCAGGT
CAAATTCTAA CATAGCAGCG CTTGAAATCC TCACAAATAA GAACTTGAAA TAAGATAAGC CACAGGAAAT TGTCCCAGGC
AATCTGACAA AATAGCTTTC ACTGAGAATA TTAGAGTACC TATCAACAAC TTTGGTTGCT TTACCCACAC AAACAATCAA
CAGTCCAGTT GCCATTGGAT CCAGAGTACC AGCATGCCCG ACCTGACATC ATATATTCAA TAAACATGTC TGTAGAGCAA
AGATCTAAAA CCACAGTATT CTACCATAAA AATCCCAAAA TTACCTTTTG CACATTCACT AATCGCCGCA GCTTTCCACA
AACAGTAAAT GAAGTCCAGC CTGGTTTACA AGAAAGGCAT ATGTTGAGCT CCATAAACTG GAGTGGAAGA CAAGAAGGTT
ATAAGTTTCT AGCAATATCC CCAAGTCTCT TTTAGACATT TACTAATCAC CTTTGTTGTG CACAAATTAA CAAAAACGGC
TGCTAGTAGG AACTAATCTA AAAGTCCACA TATGTACTGC TCATACTCAG ATAAATGAAT TGTCAGCTCA AAAATGTCCA
CCCTAACATA CATAAAATCA ACAACTCTAG TTCTCAAGGT AAGATTCTCA TCATGAAACC ATGACATAAA CTATATTTGT
AAACATACAG CAAATTCAAA TGTACGAATG TATTATATCC ATCCAGTCAC CATTTTAAAC AAAGGCTGTC GGCAAGCATT
AGTGTTGGCA CACGATGTAC TATATCTACC TATTTGCTAA TAATTTGGCA CGAATAACTG CAATGTTGCA CACAAGCTCG
CAATTGTGTA AATAGTGGTA ACATTCTAAT TTCTTACACC AGAACCAAAT TCTGATGCAA TCTCTTGAAA CGTGCATTAG
ACCGTTCATC AAGAGAGGAT AAAGAGGCAT CACCTTTGGG CTTGTCGATG AGCACGACTG TCCCGGTCGG GCCGTTCCAC
CTCGGCGGCA GCTCCGTTCT CCTGCTCGCG AGATGCGGCT GCGGCCATTC ATCCGCCTCG TGCCTCACCT GCGGAGGCTC
CTTCTTCTTC GCCTTCATCA CGTTAGCCTC GCCATGGCCA GGGCCTTTCT TCAATGACCT GAAGAAATCC TCCACCTTCC
TCTCCAACAC CTCCCCTCGA TCCTCGCCAT CCTTCTTCTT CTTCACCTCC GCCTCCTTGT TGTTATCGTC GTCGTCGAAG
AAGACGAGGC CCTTGTCGGC GGCGTCGGAG GAAGGCGGCG AGGCGTCGGC GGGGACGAAG GCGTTGTCGA GGGATTGGTC
CGGGAAGTAC TTCTTCTCGA GGCGGTAGAG CATGCGGTAG TGCTTGTCCT TCTCCCAGGG TAGCGCGAAC GCGTCGTGGA
AGTAGAGCGC CTCCTCCCGC GCGTGCAGCC GCGGGAAGTC CACCACCTCC GGCTTCAGCT CCACGAACTC CGACGAGGAG
GAGGAGGAGG GCTTGGCGGT GGTGGCGTCG GGGTCGGGGA GGAGGCGGCT GCGGCGCTTC CGGAGGTACC GGCGCTTGGC
GCGGTCGAGG TGGTCGTCGG TGGGCCGGGT GTGGCGGTCA TCGGCGGCGG AGGATTTGGG CGGATTGGGG TAGGAGGGGC
GGTAGAGGAG GAGGTCGTAG TAGAGCGGGT AGGGGGTGGC CGTCAGCGAG AGGAAGCGTC GGGGGAGGCG GAGCGGCGGC
GGCGAGGAGG AGGAGGAGAG CAGCTGCGCC GCCGCCGTGG CTCGCGCTCC GCCGCCGGTG CGAAGCAT

Locus: Os05g0108050

Loading...

Locus: Os05g0108050

Loading...