Os05t0127200-01

Locus

Os05g0127200

Description

Similar to Phospholipase C (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PLC4

CGSNL Gene Name

PHOSPHOLIPASE C4

Oryzabase Gene Symbol Synonym(s)

OsPLC4

Oryzabase Gene Name Synonym(s)

phospholipase C4, Phosphatidylinositol-hydrolyzing phospholipase C4

Transcript Evidence

AK119748 (DDBJ, Best hit)

Protein Evidence

E5G604 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid metabolic process (GO:0006629)

Biological Process: signal transduction (GO:0007165)

Biological Process: intracellular signal transduction (GO:0035556)

Molecular Function: phosphatidylinositol phospholipase C activity (GO:0004435)

Molecular Function: phospholipase C activity (GO:0004629)

Molecular Function: calcium ion binding (GO:0005509)

Molecular Function: protein binding (GO:0005515)

Molecular Function: phosphoric diester hydrolase activity (GO:0008081)

Functional domain (InterPro)

C2 calcium-dependent membrane targeting (IPR000008)

Phospholipase C, phosphatidylinositol-specific , X domain (IPR000909)

Phosphoinositide phospholipase C (IPR001192)

Phospholipase C, phosphatidylinositol-specific, Y domain (IPR001711)

C2 calcium/lipid-binding domain, CaLB (IPR008973)

EF-hand-like domain (IPR011992)

Phospholipase C, phosphoinositol-specific, EF-hand-like (IPR015359)

PLC-like phosphodiesterase, TIM beta/alpha-barrel domain (IPR017946)

C2 membrane targeting protein (IPR018029)

Full-length cDNA

002-165-F11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0127200-01)

RiceXPro (AK119748)

Others

Oryzabase (21657)

KEGG (Os05t0127200-01 (EC:3.1.4.11))

Transcript

2374 bp

>Os05t0127200-01 Similar to Phospholipase C (Fragment).
ACACCACTTGGGCTAATGCAGCGGTTGTTTTCTTCTACCTCATCATCATTCTTATATATC
TAAGTTACCATGTCGATCTGTTCCAAAATATAAGGGATTTTGACGATATATCTGATATAT
AATTAATAGATTCTCTCGCTATGTGTATATATATAGCTAGGTAGCTGAGCAAGCAGCTGG
TCATCACGGATCAAGAAGAAGATTAGCTTAGCTAGCTAAAAAGTAAGTAGCCGTGCGAAG
TCGCCGGCGGTGATCAGCCGGCGATGACGACGTACAGGGTGTGCTGCTTCCTGCGGCGGT
TCAGGGCGGCGTCGAACGAGCCGTCGGAGGAGCTCGGCGACGTGTTCCAGGCGTACGCCG
ACGGCGGCGGCGGCGTGATGGGGGAGGAGGCGCTGAGGCGGTTCCTCCGGGAGGTGCAGG
GGGAGGCCGCCGGCGGCGGCGACGACGAGCTGGAGGCGACGGCGAGGGAGGTGATGGCCT
TCGCGGCGGAGCAGAGGCTGCTCAGGAAGGGCGGCGCCGCTGCCGCCGGCGGCGGGCTCA
CCGTCGAGGGCTTCCACCGCTGGCTGTGCAGCGACGCCAACGCTGCACTGGATCCTCAGA
AACGGGTATATCAAGACATGGGATTGCCTCTGTCACACTACTTCATCTACACGGGGCACA
ACTCATACCTGACGGGGAACCAGCTGAGCAGCGGGTGCAGCGAGGTGCCCATCGTGAAGG
CCCTCCACGACGGCGTCCGTGTCATCGAGCTCGACCTCTGGCCCAACGCTGCCAAGGACG
CCGTCGAGGTCCTCCACGGCAGGACGCTGACATCGCCAGTGGGTCTGATGAAATGCCTTG
AGGCCATCAGGGAGTACGCGTTCGTCGCCTCCCCTTACCCCGTCATCCTCACCCTCGAAG
ATCACCTCACTCCCGACCTCCAATCCAAAGTCGCCAAGATGATCAAGGAGACGTTCGGTG
ACATGCTCTACGTCTCTGAAACTGAGAACATGGCGGAATTCCCTTCGCCGGACGAGCTCA
AGGGGAAGATCATCGTGTCGACGAAGCCGCCCAAGGAGTACCTCCAGACCAAGAACGACG
CCGACGCCgacgaggccggcgtctggggcgaggagatcaccgacgacaaggtggcggcga
cggcgatgacgacagaagagaaatgcgcggcggcggaggaagcagtcgccgccgccgccg
tcgacgaggagatgcaggaggccgagacggacaagaagacgcagcacgggGTGGACAACG
AGTACAGGCGCCTCATCGCCATCCCTCTGACAAGAAGAAAGCACGACATGGATCAGGACC
TCAAGGTCGATCCCGACATGGTGACGCGCCTCAGCCTCGGGGAGAAGGCCTACGAGAAGG
CCATTGTCACCCATGGAGCTCACATTATCAGGTTTACGCAGAGGAAATTGCTGAGGATAT
TCCCTCGGTCGACGCGCATTACGTCTTCGAATTATAATCCTTTGATGGGTTGGAGGTATG
GAGTTCAGATGGTTGCAGCAAACATGCAGGGCCATGGAAGAAAGCTGTGGCTGACTCAGG
GGATGTTCCGAGCAAACGGCGGTTGCGGTTACGTCAAAAAGCCTGATATTCTGATGAACA
ACGATCCAGATAAACTGTTTGATCCTACATCCAAACTACCAGTAAAGACAAGACTAAAGG
TGACGGTGTACATGGGAGACGGATGGCGATTCGACTTCCGCAAGACACATTTCGACAAAT
GCTCACCCCCAGACTTCTATGCAAGGGTGGGTATAGCCGGAGTAGAAGCAGACACGAGGA
TGGAGCAGACGAAGGTGAAGATGGACACGTGGATTCCGGCATGGGATCACGAGTTCGAGT
TCCCGTTGAGCGTGCCGGAGCTGGCGCTGCTCCGGGTGGAGGTGCACGAGTCCGACAACC
ACCAGAAGGACGACTTCGGCGGGCAGACCTGCCTGCCGGTGTGGGAGCTCCGGCGAGGCA
TCCGCTCCGTCAGGCTCTGCGACCACCGCGGCGAGCCCCTCCGCTCCGTCAAGCTCCTCA
TGCGCTTCGACTTCACCTGACTACTCCATCTTCTTCTTCATCATCGTCATCGTCTTAGTA
GTAGTAGTTCCATGTATGATATCATGAGGGATGAAGCATTGATCGtactttctccgtccc
gaaatatagcaatgtaggattagatggaaacatcttaatactacgaatctggatatgtcc
TATCTGGTTCTGGTTTGCTATGTTTTAGGACGAATATAGTACATAAAATTTTAGAAGTTT
TGTTTTAAAAAAGAATAAATTTTGTGCGAAACGGAAGGTGTGATTGTACATTTTGTACGT
ACATTGTTTGTTGTTGATTAATAAACGTGTTAAT

CDS

1797 bp

>Os05t0127200-01 Similar to Phospholipase C (Fragment).
ATGACGACGTACAGGGTGTGCTGCTTCCTGCGGCGGTTCAGGGCGGCGTCGAACGAGCCG
TCGGAGGAGCTCGGCGACGTGTTCCAGGCGTACGCCGACGGCGGCGGCGGCGTGATGGGG
GAGGAGGCGCTGAGGCGGTTCCTCCGGGAGGTGCAGGGGGAGGCCGCCGGCGGCGGCGAC
GACGAGCTGGAGGCGACGGCGAGGGAGGTGATGGCCTTCGCGGCGGAGCAGAGGCTGCTC
AGGAAGGGCGGCGCCGCTGCCGCCGGCGGCGGGCTCACCGTCGAGGGCTTCCACCGCTGG
CTGTGCAGCGACGCCAACGCTGCACTGGATCCTCAGAAACGGGTATATCAAGACATGGGA
TTGCCTCTGTCACACTACTTCATCTACACGGGGCACAACTCATACCTGACGGGGAACCAG
CTGAGCAGCGGGTGCAGCGAGGTGCCCATCGTGAAGGCCCTCCACGACGGCGTCCGTGTC
ATCGAGCTCGACCTCTGGCCCAACGCTGCCAAGGACGCCGTCGAGGTCCTCCACGGCAGG
ACGCTGACATCGCCAGTGGGTCTGATGAAATGCCTTGAGGCCATCAGGGAGTACGCGTTC
GTCGCCTCCCCTTACCCCGTCATCCTCACCCTCGAAGATCACCTCACTCCCGACCTCCAA
TCCAAAGTCGCCAAGATGATCAAGGAGACGTTCGGTGACATGCTCTACGTCTCTGAAACT
GAGAACATGGCGGAATTCCCTTCGCCGGACGAGCTCAAGGGGAAGATCATCGTGTCGACG
AAGCCGCCCAAGGAGTACCTCCAGACCAAGAACGACGCCGACGCCgacgaggccggcgtc
tggggcgaggagatcaccgacgacaaggtggcggcgacggcgatgacgacagaagagaaa
tgcgcggcggcggaggaagcagtcgccgccgccgccgtcgacgaggagatgcaggaggcc
gagacggacaagaagacgcagcacgggGTGGACAACGAGTACAGGCGCCTCATCGCCATC
CCTCTGACAAGAAGAAAGCACGACATGGATCAGGACCTCAAGGTCGATCCCGACATGGTG
ACGCGCCTCAGCCTCGGGGAGAAGGCCTACGAGAAGGCCATTGTCACCCATGGAGCTCAC
ATTATCAGGTTTACGCAGAGGAAATTGCTGAGGATATTCCCTCGGTCGACGCGCATTACG
TCTTCGAATTATAATCCTTTGATGGGTTGGAGGTATGGAGTTCAGATGGTTGCAGCAAAC
ATGCAGGGCCATGGAAGAAAGCTGTGGCTGACTCAGGGGATGTTCCGAGCAAACGGCGGT
TGCGGTTACGTCAAAAAGCCTGATATTCTGATGAACAACGATCCAGATAAACTGTTTGAT
CCTACATCCAAACTACCAGTAAAGACAAGACTAAAGGTGACGGTGTACATGGGAGACGGA
TGGCGATTCGACTTCCGCAAGACACATTTCGACAAATGCTCACCCCCAGACTTCTATGCA
AGGGTGGGTATAGCCGGAGTAGAAGCAGACACGAGGATGGAGCAGACGAAGGTGAAGATG
GACACGTGGATTCCGGCATGGGATCACGAGTTCGAGTTCCCGTTGAGCGTGCCGGAGCTG
GCGCTGCTCCGGGTGGAGGTGCACGAGTCCGACAACCACCAGAAGGACGACTTCGGCGGG
CAGACCTGCCTGCCGGTGTGGGAGCTCCGGCGAGGCATCCGCTCCGTCAGGCTCTGCGAC
CACCGCGGCGAGCCCCTCCGCTCCGTCAAGCTCCTCATGCGCTTCGACTTCACCTGA

Protein

599 aa

>Os05t0127200-01 Similar to Phospholipase C (Fragment).
MTTYRVCCFLRRFRAASNEPSEELGDVFQAYADGGGGVMGEEALRRFLREVQGEAAGGGD
DELEATAREVMAFAAEQRLLRKGGAAAAGGGLTVEGFHRWLCSDANAALDPQKRVYQDMG
LPLSHYFIYTGHNSYLTGNQLSSGCSEVPIVKALHDGVRVIELDLWPNAAKDAVEVLHGR
TLTSPVGLMKCLEAIREYAFVASPYPVILTLEDHLTPDLQSKVAKMIKETFGDMLYVSET
ENMAEFPSPDELKGKIIVSTKPPKEYLQTKNDADADEAGVWGEEITDDKVAATAMTTEEK
CAAAEEAVAAAAVDEEMQEAETDKKTQHGVDNEYRRLIAIPLTRRKHDMDQDLKVDPDMV
TRLSLGEKAYEKAIVTHGAHIIRFTQRKLLRIFPRSTRITSSNYNPLMGWRYGVQMVAAN
MQGHGRKLWLTQGMFRANGGCGYVKKPDILMNNDPDKLFDPTSKLPVKTRLKVTVYMGDG
WRFDFRKTHFDKCSPPDFYARVGIAGVEADTRMEQTKVKMDTWIPAWDHEFEFPLSVPEL
ALLRVEVHESDNHQKDDFGGQTCLPVWELRRGIRSVRLCDHRGEPLRSVKLLMRFDFT*

5'UTR

chr05:1535764..1536026 (+ strand) : 263 bp

CDS

chr05:1536027..1536368 (+ strand) : 342 bp

chr05:1537845..1538041 (+ strand) : 197 bp

chr05:1538875..1539010 (+ strand) : 136 bp

chr05:1539105..1539577 (+ strand) : 473 bp

chr05:1539686..1539803 (+ strand) : 118 bp

chr05:1540161..1540310 (+ strand) : 150 bp

chr05:1540438..1540524 (+ strand) : 87 bp

chr05:1540935..1541228 (+ strand) : 294 bp

3'UTR

chr05:1541229..1541542 (+ strand) : 314 bp

FASTA

>Os05t0127200-01 class=Sequence position=chr05:1535764..1541542 (+ strand)
ACACCACTTG GGCTAATGCA GCGGTTGTTT TCTTCTACCT CATCATCATT CTTATATATC TAAGTTACCA TGTCGATCTG
TTCCAAAATA TAAGGGATTT TGACGATATA TCTGATATAT AATTAATAGA TTCTCTCGCT ATGTGTATAT ATATAGCTAG
GTAGCTGAGC AAGCAGCTGG TCATCACGGA TCAAGAAGAA GATTAGCTTA GCTAGCTAAA AAGTAAGTAG CCGTGCGAAG
TCGCCGGCGG TGATCAGCCG GCGATGACGA CGTACAGGGT GTGCTGCTTC CTGCGGCGGT TCAGGGCGGC GTCGAACGAG
CCGTCGGAGG AGCTCGGCGA CGTGTTCCAG GCGTACGCCG ACGGCGGCGG CGGCGTGATG GGGGAGGAGG CGCTGAGGCG
GTTCCTCCGG GAGGTGCAGG GGGAGGCCGC CGGCGGCGGC GACGACGAGC TGGAGGCGAC GGCGAGGGAG GTGATGGCCT
TCGCGGCGGA GCAGAGGCTG CTCAGGAAGG GCGGCGCCGC TGCCGCCGGC GGCGGGCTCA CCGTCGAGGG CTTCCACCGC
TGGCTGTGCA GCGACGCCAA CGCTGCACTG GATCCTCAGA AACGGGTACG TACTTAATTT ACGTGATTAG TTAGCTAATT
AAACTCGTAA TTAACACCTA ATTAATCATG ATTATGCATG GATTCGACGA TCTCTTCCTC CATCATATAG CTTAATTAGC
TACTCTTGTG TTCAATAGAT ACTACTATTA ACAAATGAGT GTGAAATCAA TCTGTAATAA TAATAATAAT AATAATAATA
ATAATAATAA TAATAATAAT AATAATAATA ATAATAATAA TTGATAATAA TGCTCCTCCT ATGCTTTTCC TTTTTTTTTT
ACGGAAGAAT GTAGAGTAGG CTTTACCTTA TAGTCATTTC ATTAATAGAA ATGAGGTTTA CAGATTACAT ATTAGGTGTG
GGAATCATCA GAGAGAAAAA AAGAACAAAA AGCAGAACAA ACCAAAACAG AAAAAGAGAT AATTTACAGA TATATGTACA
TGCCTATGTT CTTCTATAGA AACTATATCC CAGTTACTTA TTATGCGTAT ATATATAAGG AATTAATTCA CATTCAGGAG
CAACTAGGCA AGGCCTTCAT CGTCAGATAC TGTACATGGA TAATCATACA GAGGCTAACC ATGGCCATGC AACCTAGGGA
CCATGGATGA GCTCTCACAA GCGCCTCCAA AACAAAAGAA GATAAGGTCC CTAGTCATAT GAGAATGGAG AACAGGTCGA
TGATAttgga ataagtgaat tcccgtcttt cattatcagt ctaaattttt tattcaaacc aattgacgca tgcaactcaa
tatagtatca gtcccaagtt taaaccctag ttggcatata attaaataaa aaatacaaca tatttctatc tgaggtttga
ggggacctcg tgtgaaggga agtgttgaaa tataagtgaa ttgtccgttt ttcttcatca gcttaaactt ttgggttaaa
ctgttcggga tgtattacac aatagtGAAA AGAATCTGTG TATACAACTC AATGGTGTGA AGGAGAAATT GGTCGAGTCT
ATAGAGGGGT CGGTGCGTAC AACTCAATCG TGGGAAGTGA AGAGGAGGTC GGTGTGTACA ACTCAACAGT GGGAAGTGAA
GAGGGAGGTT GGTGTGTACA ACTCTATTTT TTTAGATAAA GACAACTCAA TTAATAGTGG GAAGTAGGGG GGGGGGGAAG
GAGGGGGGGA TCGGTGTGTA CAATTCAATA GTGTAGAAGG GGAAATTCAG ATGAGCATGT TGCTGCCCAT GCGCAGAGCT
ACGAGAAGAC TGCTTTTGCG GTTTCGCCTA GGACACATGC CATGTGAAAA TATCAAGTCC TTTCGGTGAG CGAAGGACCG
AAGTCCTACA TAACTTTTTC CCTTGTTTGG TACTCGATAA ACCAAAACCA AACCGTAAAA ACTGAATATA TATTCATGTA
AAAAAATAAT CCTCGCTATA CAAATAAGTT GAAAGATATA GCTACAAAAT AAGCAGATGT CTCTCTATGT TATGGGTGCA
GGTATATCAA GACATGGGAT TGCCTCTGTC ACACTACTTC ATCTACACGG GGCACAACTC ATACCTGACG GGGAACCAGC
TGAGCAGCGG GTGCAGCGAG GTGCCCATCG TGAAGGCCCT CCACGACGGC GTCCGTGTCA TCGAGCTCGA CCTCTGGCCC
AACGCTGCCA AGGACGCCGT CGAGGTCCTC CACGGCAGGT GATCCGCTCG ATCAACCACC ATCCTACCTT CCTCCAATCT
CCATTGCATC CTTAATTTCA ATTCACGACA GATTTTTGCT ATACGACACT AGTCCCTTTG TCCACAGATT TTGAGCAATT
TTACCCATCC TATATTTATA CCTCGAGGTA CCACATTTTG CACATAAAAT TTTAATACCT TGGATATCAA CTTTTACACT
ATAAAGTACC TCGAGGTACC CAAAAATTGG TACCAAATAT TGGACGCTAA AATTACTCTA ATTTTTTGTT TTAATTTTCC
ATTTCAATCG TCCTCTCATG TAATTTCATC ATCTACTACT CATCCTAACT AGGCGATGAA AATCGTGGTA TGAATTTTAT
CTTAATTTTA TTATATTCTA AAACATTAAA ATACTCATAT TTTTTGGATG AAAGTAGCTG TTAACTATGT TAATTTGTGA
AATTTATGTT CAATATAACA GTGCCTATGA TTAAAAGTGC ATTAAAATTA AAAAAAAGGT TTAGTGGCCA TCCTAGCCGT
TGTGTATTTG CTGATGGGTT GTCCTAAATT AATTAATTAG AAAACCAAAT TAACTACTGC AGATTCAACG AATTAAATTA
AATTAATGAA ATGGAAACAA GACCAAACTA TGGACCTATA TGGGCCAAAA TAAATCTACC GGCCCGTCAT TAGGAGATAG
AGTAGGCCCA TGGGCAATGA GGTGGCCCAT GGGCCGCGTC CATCACCGGC CTGCTTCACG ACGCCGCCGC GCGCGCCGCG
ACCCGTCGGC TTCAGCTCAC CGTTGCCAGC CGTCGCCGGA GAAGAAGCTG ACGACGATTT CGCTCCCGCA GGACGCTGAC
ATCGCCAGTG GGTCTGATGA AATGCCTTGA GGCCATCAGG GAGTACGCGT TCGTCGCCTC CCCTTACCCC GTCATCCTCA
CCCTCGAAGA TCACCTCACT CCCGACCTCC AATCCAAAGT CGCCAAGGTG AACACGCATT TGCCATCTCG ATCACCTCAC
CTTCTTCTTC CTCCATATAC TGACAATGGC GGCATCGATC GATGGATTTT CACTCGCGCA GATGATCAAG GAGACGTTCG
GTGACATGCT CTACGTCTCT GAAACTGAGA ACATGGCGGA ATTCCCTTCG CCGGACGAGC TCAAGGGGAA GATCATCGTG
TCGACGAAGC CGCCCAAGGA GTACCTCCAG ACCAAGAACG ACGCCGACGC Cgacgaggcc ggcgtctggg gcgaggagat
caccgacgac aaggtggcgg cgacggcgat gacgacagaa gagaaatgcg cggcggcgga ggaagcagtc gccgccgccg
ccgtcgacga ggagatgcag gaggccgaga cggacaagaa gacgcagcac gggGTGGACA ACGAGTACAG GCGCCTCATC
GCCATCCCTC TGACAAGAAG AAAGCACGAC ATGGATCAGG ACCTCAAGGT CGATCCCGAC ATGGTGACGC GCCTCAGCCT
CGGGGAGAAG GCCTACGAGA AGGCCATTGT CACCCATGGA GCTCACATTA TCAGGTGATT TCAGCTTTAG TAACATGACA
GGTTTAGTTT GCATGTACAG CTTATTCTGA ACTGAACTCT GTGTCTGACA GGATTAGTGT TCTTGTTCTT GTTCTTGTTC
AGGTTTACGC AGAGGAAATT GCTGAGGATA TTCCCTCGGT CGACGCGCAT TACGTCTTCG AATTATAATC CTTTGATGGG
TTGGAGGTAT GGAGTTCAGA TGGTTGCAGC AAACATGCAG GTAACTAGTG CAATTTATGT TATTTCTGTC ACACTATTAA
TAATGGTCTT ATTCTGCATG ATAAGCACAT GAGTCATCAT GTTTACTTTT TCAGTTCAGC ATTGCAATTG TGTTACATAT
AGTGGAGTGG TATTCTATTT AACAAATCAC AACTTAGTTT GAACTAGTGA ACTGGGATAT CCTCTTGCAG AGTTGCAGTA
TAAAAGGATT GTAGCAAGGA AACATTTTTT GTGTCTTTTT CTAAAATCAG GTCTAGCACA AGGAAAGTAC TGAATAGTTT
TTAAAAAAAA GGCTTTGTGA AGATACATAA TAGTTCACCC ACTTTGATCT GAGCTATCTG CTACCATTCA TGTTCAGGGC
CATGGAAGAA AGCTGTGGCT GACTCAGGGG ATGTTCCGAG CAAACGGCGG TTGCGGTTAC GTCAAAAAGC CTGATATTCT
GATGAACAAC GATCCAGATA AACTGTTTGA TCCTACATCC AAACTACCAG TAAAGACAAG ACTAAAGGTA AACTGGACAA
AAGCTAAATT TCCTTTTATT ACCGGAAGAT CCCAAATGTG CTACTACTAT TTTTCATATC TGCTACAGTA ACTGAAAGTC
TGTAACCATT GTGTCAATGC TACAAAATCT GAAGGTGACG GTGTACATGG GAGACGGATG GCGATTCGAC TTCCGCAAGA
CACATTTCGA CAAATGCTCA CCCCCAGACT TCTATGCAAG GGTTAGCATT CTGATCAATC TCATGtacta cttccgtttt
ttaatagatg atgtcattaa cttttagaca catgcttaac cattcatctt attcaaaaag tttcgtaatt atagtttatt
ttgttgtgag ttgtttttat cactagaact actttaaagc atgatttata tcttatgtat ttgcaaaaaa aattaaataa
gacgaagatc aaacgtgagc ccagaagtta acgacgtctc atcttttaaa aaacaaagag agtaCTACAT ATCTAACAAA
TTAATCGATT ACCTAAGATG TACTGAAACT CTGAATGAGC TGTACACAGA GAAGCAAACT CTGAATGTTC AGTTCAGACT
TCAGACATGG CAAATGGCTG ACAAGAAAAG AAAAACTGAA AACTACTGCA GGTGGGTATA GCCGGAGTAG AAGCAGACAC
GAGGATGGAG CAGACGAAGG TGAAGATGGA CACGTGGATT CCGGCATGGG ATCACGAGTT CGAGTTCCCG TTGAGCGTGC
CGGAGCTGGC GCTGCTCCGG GTGGAGGTGC ACGAGTCCGA CAACCACCAG AAGGACGACT TCGGCGGGCA GACCTGCCTG
CCGGTGTGGG AGCTCCGGCG AGGCATCCGC TCCGTCAGGC TCTGCGACCA CCGCGGCGAG CCCCTCCGCT CCGTCAAGCT
CCTCATGCGC TTCGACTTCA CCTGACTACT CCATCTTCTT CTTCATCATC GTCATCGTCT TAGTAGTAGT AGTTCCATGT
ATGATATCAT GAGGGATGAA GCATTGATCG tactttctcc gtcccgaaat atagcaatgt aggattagat ggaaacatct
taatactacg aatctggata tgtccTATCT GGTTCTGGTT TGCTATGTTT TAGGACGAAT ATAGTACATA AAATTTTAGA
AGTTTTGTTT TAAAAAAGAA TAAATTTTGT GCGAAACGGA AGGTGTGATT GTACATTTTG TACGTACATT GTTTGTTGTT
GATTAATAAA CGTGTTAAT

Locus: Os05g0127200

Loading...

Locus: Os05g0127200

Loading...