Os05t0127200-02

Locus

Os05g0127200

Description

Similar to Phospholipase C (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PLC4

CGSNL Gene Name

PHOSPHOLIPASE C4

Oryzabase Gene Symbol Synonym(s)

OsPLC4

Oryzabase Gene Name Synonym(s)

phospholipase C4, Phosphatidylinositol-hydrolyzing phospholipase C4

Transcript Evidence

AK064924 (DDBJ, Best hit)

Protein Evidence

E5G604 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid metabolic process (GO:0006629)

Biological Process: signal transduction (GO:0007165)

Biological Process: intracellular signal transduction (GO:0035556)

Molecular Function: phosphatidylinositol phospholipase C activity (GO:0004435)

Molecular Function: phospholipase C activity (GO:0004629)

Molecular Function: calcium ion binding (GO:0005509)

Molecular Function: protein binding (GO:0005515)

Molecular Function: phosphoric diester hydrolase activity (GO:0008081)

Functional domain (InterPro)

C2 calcium-dependent membrane targeting (IPR000008)

Phospholipase C, phosphatidylinositol-specific , X domain (IPR000909)

Phosphoinositide phospholipase C (IPR001192)

Phospholipase C, phosphatidylinositol-specific, Y domain (IPR001711)

C2 calcium/lipid-binding domain, CaLB (IPR008973)

EF-hand-like domain (IPR011992)

Phospholipase C, phosphoinositol-specific, EF-hand-like (IPR015359)

PLC-like phosphodiesterase, TIM beta/alpha-barrel domain (IPR017946)

C2 membrane targeting protein (IPR018029)

Full-length cDNA

J013000N15 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0127200-02)

RiceXPro (AK064924)

Others

Oryzabase (21657)

KEGG (Os05t0127200-02 (EC:3.1.4.11))

Transcript

2217 bp

>Os05t0127200-02 Similar to Phospholipase C (Fragment).
GGTCATCACGGATCAAGAAGAAGATTAGCTTAGCTAGCTAAAAAGTAAGTAGCCGTGCGA
AGTCGCCGGCGGTGATCAGCCGGCGATGACGACGTACAGGGTGTGCTGCTTCCTGCGGCG
GTTCAGGGCGGCGTCGAACGAGCCGTCGGAGGAGCTCGGCGACGTGTTCCAGGCGTACGC
CGACGGCGGCGGCGGCGTGATGGGGGAGGAGGCGCTGAGGCGGTTCCTCCGGGAGGTGCA
GGGGGAGGCCGCCGGCGGCGGCGACGACGAGCTGGAGGCGACGGCGAGGGAGGTGATGGC
CTTCGCGGCGGAGCAGAGGCTGCTCAGGAAGGGCGGCGCCGCTGCCGCCGGCGGCGGGCT
CACCGTCGAGGGCTTCCACCGCTGGCTGTGCAGCGACGCCAACGCTGCACTGGATCCTCA
GAAACGGGTATATCAAGACATGGGATTGCCTCTGTCACACTACTTCATCTACACGGGGCA
CAACTCATACCTGACGGGGAACCAGCTGAGCAGCGGGTGCAGCGAGGTGCCCATCGTGAA
GGCCCTCCACGACGGCGTCCGTGTCATCGAGCTCGACCTCTGGCCCAACGCTGCCAAGGA
CGCCGTCGAGGTCCTCCACGGCAGGACGCTGACATCGCCAGTGGGTCTGATGAAATGCCT
TGAGGCCATCAGGGAGTACGCGTTCGTCGCCTCCCCTTACCCCGTCATCCTCACCCTCGA
AGATCACCTCACTCCCGACCTCCAATCCAAAGTCGCCAAGATGATCAAGGAGACGTTCGG
TGACATGCTCTACGTCTCTGAAACTGAGAACATGGCGGAATTCCCTTCGCCGGACGAGCT
CAAGGGGAAGATCATCGTGTCGACGAAGCCGCCCAAGGAGTACCTCCAGACCAAGAACGA
CGCCGACGCCgacgaggccggcgtctggggcgaggagatcaccgacgacaaggtggcggc
gacggcgatgacgacagaagagaaatgcgcggcggcggaggaagcagtcgccgccgccgc
cgtcgacgaggagatgcaggaggccgagacggacaagaagacgcagcacgggGTGGACAA
CGAGTACAGGCGCCTCATCGCCATCCCTCTGACAAGAAGAAAGCACGACATGGATCAGGA
CCTCAAGGTCGATCCCGACATGGTGACGCGCCTCAGCCTCGGGGAGAAGGCCTACGAGAA
GGCCATTGTCACCCATGGAGCTCACATTATCAGGTTTACGCAGAGGAAATTGCTGAGGAT
ATTCCCTCGGTCGACGCGCATTACGTCTTCGAATTATAATCCTTTGATGGGTTGGAGGTA
TGGAGTTCAGATGGTTGCAGCAAACATGCAGGGCCATGGAAGAAAGCTGTGGCTGACTCA
GGGGATGTTCCGAGCAAACGGCGGTTGCGGTTACGTCAAAAAGCCTGATATTCTGATGAA
CAACGATCCAGATAAACTGTTTGATCCTACATCCAAACTACCAGTAAAGACAAGACTAAA
GGTGACGGTGTACATGGGAGACGGATGGCGATTCGACTTCCGCAAGACACATTTCGACAA
ATGCTCACCCCCAGACTTCTATGCAAGGGTGGGTATAGCCGGAGTAGAAGCAGACACGAG
GATGGAGCAGACGAAGGTGAAGATGGACACGTGGATTCCGGCATGGGATCACGAGTTCGA
GTTCCCGTTGAGCGTGCCGGAGCTGGCGCTGCTCCGGGTGGAGGTGCACGAGTCCGACAA
CCACCAGAAGGACGACTTCGGCGGGCAGACCTGCCTGCCGGTGTGGGAGCTCCGGCGAGG
CATCCGCTCCGTCAGGCTCTGCGACCACCGCGGCGAGCCCCTCCGCTCCGTCAAGCTCCT
CATGCGCTTCGACTTCACCTGACTACTCCATCTTCTTCTTCATCATCGTCATCGTCTTAG
TAGTAGTAGTTCCATGTATGATATCATGAGGGATGAAGCATTGATCGtactttctccgtc
ccgaaatatagcaatgtaggattagatggaaacatcttaatactacgaatctggatatgt
ccTATCTGGTTCTGGTTTGCTATGTTTTAGGACGAATATAGTACATAAAATTTTAGAAGT
TTTGTTTTAAAAAAGAATAAATTTTGTGCGAAACGGAAGGTGTGATTGTACATTTTGTAC
GTACATTGTTTGTTGTTGATTAATAAACGTGTTAATAAAAGAGGGAAGGATTCTTTT

CDS

1797 bp

>Os05t0127200-02 Similar to Phospholipase C (Fragment).
ATGACGACGTACAGGGTGTGCTGCTTCCTGCGGCGGTTCAGGGCGGCGTCGAACGAGCCG
TCGGAGGAGCTCGGCGACGTGTTCCAGGCGTACGCCGACGGCGGCGGCGGCGTGATGGGG
GAGGAGGCGCTGAGGCGGTTCCTCCGGGAGGTGCAGGGGGAGGCCGCCGGCGGCGGCGAC
GACGAGCTGGAGGCGACGGCGAGGGAGGTGATGGCCTTCGCGGCGGAGCAGAGGCTGCTC
AGGAAGGGCGGCGCCGCTGCCGCCGGCGGCGGGCTCACCGTCGAGGGCTTCCACCGCTGG
CTGTGCAGCGACGCCAACGCTGCACTGGATCCTCAGAAACGGGTATATCAAGACATGGGA
TTGCCTCTGTCACACTACTTCATCTACACGGGGCACAACTCATACCTGACGGGGAACCAG
CTGAGCAGCGGGTGCAGCGAGGTGCCCATCGTGAAGGCCCTCCACGACGGCGTCCGTGTC
ATCGAGCTCGACCTCTGGCCCAACGCTGCCAAGGACGCCGTCGAGGTCCTCCACGGCAGG
ACGCTGACATCGCCAGTGGGTCTGATGAAATGCCTTGAGGCCATCAGGGAGTACGCGTTC
GTCGCCTCCCCTTACCCCGTCATCCTCACCCTCGAAGATCACCTCACTCCCGACCTCCAA
TCCAAAGTCGCCAAGATGATCAAGGAGACGTTCGGTGACATGCTCTACGTCTCTGAAACT
GAGAACATGGCGGAATTCCCTTCGCCGGACGAGCTCAAGGGGAAGATCATCGTGTCGACG
AAGCCGCCCAAGGAGTACCTCCAGACCAAGAACGACGCCGACGCCgacgaggccggcgtc
tggggcgaggagatcaccgacgacaaggtggcggcgacggcgatgacgacagaagagaaa
tgcgcggcggcggaggaagcagtcgccgccgccgccgtcgacgaggagatgcaggaggcc
gagacggacaagaagacgcagcacgggGTGGACAACGAGTACAGGCGCCTCATCGCCATC
CCTCTGACAAGAAGAAAGCACGACATGGATCAGGACCTCAAGGTCGATCCCGACATGGTG
ACGCGCCTCAGCCTCGGGGAGAAGGCCTACGAGAAGGCCATTGTCACCCATGGAGCTCAC
ATTATCAGGTTTACGCAGAGGAAATTGCTGAGGATATTCCCTCGGTCGACGCGCATTACG
TCTTCGAATTATAATCCTTTGATGGGTTGGAGGTATGGAGTTCAGATGGTTGCAGCAAAC
ATGCAGGGCCATGGAAGAAAGCTGTGGCTGACTCAGGGGATGTTCCGAGCAAACGGCGGT
TGCGGTTACGTCAAAAAGCCTGATATTCTGATGAACAACGATCCAGATAAACTGTTTGAT
CCTACATCCAAACTACCAGTAAAGACAAGACTAAAGGTGACGGTGTACATGGGAGACGGA
TGGCGATTCGACTTCCGCAAGACACATTTCGACAAATGCTCACCCCCAGACTTCTATGCA
AGGGTGGGTATAGCCGGAGTAGAAGCAGACACGAGGATGGAGCAGACGAAGGTGAAGATG
GACACGTGGATTCCGGCATGGGATCACGAGTTCGAGTTCCCGTTGAGCGTGCCGGAGCTG
GCGCTGCTCCGGGTGGAGGTGCACGAGTCCGACAACCACCAGAAGGACGACTTCGGCGGG
CAGACCTGCCTGCCGGTGTGGGAGCTCCGGCGAGGCATCCGCTCCGTCAGGCTCTGCGAC
CACCGCGGCGAGCCCCTCCGCTCCGTCAAGCTCCTCATGCGCTTCGACTTCACCTGA

Protein

599 aa

>Os05t0127200-02 Similar to Phospholipase C (Fragment).
MTTYRVCCFLRRFRAASNEPSEELGDVFQAYADGGGGVMGEEALRRFLREVQGEAAGGGD
DELEATAREVMAFAAEQRLLRKGGAAAAGGGLTVEGFHRWLCSDANAALDPQKRVYQDMG
LPLSHYFIYTGHNSYLTGNQLSSGCSEVPIVKALHDGVRVIELDLWPNAAKDAVEVLHGR
TLTSPVGLMKCLEAIREYAFVASPYPVILTLEDHLTPDLQSKVAKMIKETFGDMLYVSET
ENMAEFPSPDELKGKIIVSTKPPKEYLQTKNDADADEAGVWGEEITDDKVAATAMTTEEK
CAAAEEAVAAAAVDEEMQEAETDKKTQHGVDNEYRRLIAIPLTRRKHDMDQDLKVDPDMV
TRLSLGEKAYEKAIVTHGAHIIRFTQRKLLRIFPRSTRITSSNYNPLMGWRYGVQMVAAN
MQGHGRKLWLTQGMFRANGGCGYVKKPDILMNNDPDKLFDPTSKLPVKTRLKVTVYMGDG
WRFDFRKTHFDKCSPPDFYARVGIAGVEADTRMEQTKVKMDTWIPAWDHEFEFPLSVPEL
ALLRVEVHESDNHQKDDFGGQTCLPVWELRRGIRSVRLCDHRGEPLRSVKLLMRFDFT*

5'UTR

chr05:1535942..1536026 (+ strand) : 85 bp

CDS

chr05:1536027..1536368 (+ strand) : 342 bp

chr05:1537845..1538041 (+ strand) : 197 bp

chr05:1538875..1539010 (+ strand) : 136 bp

chr05:1539105..1539577 (+ strand) : 473 bp

chr05:1539686..1539803 (+ strand) : 118 bp

chr05:1540161..1540310 (+ strand) : 150 bp

chr05:1540438..1540524 (+ strand) : 87 bp

chr05:1540935..1541228 (+ strand) : 294 bp

3'UTR

chr05:1541229..1541563 (+ strand) : 335 bp

FASTA

>Os05t0127200-02 class=Sequence position=chr05:1535942..1541563 (+ strand)
GGTCATCACG GATCAAGAAG AAGATTAGCT TAGCTAGCTA AAAAGTAAGT AGCCGTGCGA AGTCGCCGGC GGTGATCAGC
CGGCGATGAC GACGTACAGG GTGTGCTGCT TCCTGCGGCG GTTCAGGGCG GCGTCGAACG AGCCGTCGGA GGAGCTCGGC
GACGTGTTCC AGGCGTACGC CGACGGCGGC GGCGGCGTGA TGGGGGAGGA GGCGCTGAGG CGGTTCCTCC GGGAGGTGCA
GGGGGAGGCC GCCGGCGGCG GCGACGACGA GCTGGAGGCG ACGGCGAGGG AGGTGATGGC CTTCGCGGCG GAGCAGAGGC
TGCTCAGGAA GGGCGGCGCC GCTGCCGCCG GCGGCGGGCT CACCGTCGAG GGCTTCCACC GCTGGCTGTG CAGCGACGCC
AACGCTGCAC TGGATCCTCA GAAACGGGTA CGTACTTAAT TTACGTGATT AGTTAGCTAA TTAAACTCGT AATTAACACC
TAATTAATCA TGATTATGCA TGGATTCGAC GATCTCTTCC TCCATCATAT AGCTTAATTA GCTACTCTTG TGTTCAATAG
ATACTACTAT TAACAAATGA GTGTGAAATC AATCTGTAAT AATAATAATA ATAATAATAA TAATAATAAT AATAATAATA
ATAATAATAA TAATAATAAT AATTGATAAT AATGCTCCTC CTATGCTTTT CCTTTTTTTT TTACGGAAGA ATGTAGAGTA
GGCTTTACCT TATAGTCATT TCATTAATAG AAATGAGGTT TACAGATTAC ATATTAGGTG TGGGAATCAT CAGAGAGAAA
AAAAGAACAA AAAGCAGAAC AAACCAAAAC AGAAAAAGAG ATAATTTACA GATATATGTA CATGCCTATG TTCTTCTATA
GAAACTATAT CCCAGTTACT TATTATGCGT ATATATATAA GGAATTAATT CACATTCAGG AGCAACTAGG CAAGGCCTTC
ATCGTCAGAT ACTGTACATG GATAATCATA CAGAGGCTAA CCATGGCCAT GCAACCTAGG GACCATGGAT GAGCTCTCAC
AAGCGCCTCC AAAACAAAAG AAGATAAGGT CCCTAGTCAT ATGAGAATGG AGAACAGGTC GATGATAttg gaataagtga
attcccgtct ttcattatca gtctaaattt tttattcaaa ccaattgacg catgcaactc aatatagtat cagtcccaag
tttaaaccct agttggcata taattaaata aaaaatacaa catatttcta tctgaggttt gaggggacct cgtgtgaagg
gaagtgttga aatataagtg aattgtccgt ttttcttcat cagcttaaac ttttgggtta aactgttcgg gatgtattac
acaatagtGA AAAGAATCTG TGTATACAAC TCAATGGTGT GAAGGAGAAA TTGGTCGAGT CTATAGAGGG GTCGGTGCGT
ACAACTCAAT CGTGGGAAGT GAAGAGGAGG TCGGTGTGTA CAACTCAACA GTGGGAAGTG AAGAGGGAGG TTGGTGTGTA
CAACTCTATT TTTTTAGATA AAGACAACTC AATTAATAGT GGGAAGTAGG GGGGGGGGGA AGGAGGGGGG GATCGGTGTG
TACAATTCAA TAGTGTAGAA GGGGAAATTC AGATGAGCAT GTTGCTGCCC ATGCGCAGAG CTACGAGAAG ACTGCTTTTG
CGGTTTCGCC TAGGACACAT GCCATGTGAA AATATCAAGT CCTTTCGGTG AGCGAAGGAC CGAAGTCCTA CATAACTTTT
TCCCTTGTTT GGTACTCGAT AAACCAAAAC CAAACCGTAA AAACTGAATA TATATTCATG TAAAAAAATA ATCCTCGCTA
TACAAATAAG TTGAAAGATA TAGCTACAAA ATAAGCAGAT GTCTCTCTAT GTTATGGGTG CAGGTATATC AAGACATGGG
ATTGCCTCTG TCACACTACT TCATCTACAC GGGGCACAAC TCATACCTGA CGGGGAACCA GCTGAGCAGC GGGTGCAGCG
AGGTGCCCAT CGTGAAGGCC CTCCACGACG GCGTCCGTGT CATCGAGCTC GACCTCTGGC CCAACGCTGC CAAGGACGCC
GTCGAGGTCC TCCACGGCAG GTGATCCGCT CGATCAACCA CCATCCTACC TTCCTCCAAT CTCCATTGCA TCCTTAATTT
CAATTCACGA CAGATTTTTG CTATACGACA CTAGTCCCTT TGTCCACAGA TTTTGAGCAA TTTTACCCAT CCTATATTTA
TACCTCGAGG TACCACATTT TGCACATAAA ATTTTAATAC CTTGGATATC AACTTTTACA CTATAAAGTA CCTCGAGGTA
CCCAAAAATT GGTACCAAAT ATTGGACGCT AAAATTACTC TAATTTTTTG TTTTAATTTT CCATTTCAAT CGTCCTCTCA
TGTAATTTCA TCATCTACTA CTCATCCTAA CTAGGCGATG AAAATCGTGG TATGAATTTT ATCTTAATTT TATTATATTC
TAAAACATTA AAATACTCAT ATTTTTTGGA TGAAAGTAGC TGTTAACTAT GTTAATTTGT GAAATTTATG TTCAATATAA
CAGTGCCTAT GATTAAAAGT GCATTAAAAT TAAAAAAAAG GTTTAGTGGC CATCCTAGCC GTTGTGTATT TGCTGATGGG
TTGTCCTAAA TTAATTAATT AGAAAACCAA ATTAACTACT GCAGATTCAA CGAATTAAAT TAAATTAATG AAATGGAAAC
AAGACCAAAC TATGGACCTA TATGGGCCAA AATAAATCTA CCGGCCCGTC ATTAGGAGAT AGAGTAGGCC CATGGGCAAT
GAGGTGGCCC ATGGGCCGCG TCCATCACCG GCCTGCTTCA CGACGCCGCC GCGCGCGCCG CGACCCGTCG GCTTCAGCTC
ACCGTTGCCA GCCGTCGCCG GAGAAGAAGC TGACGACGAT TTCGCTCCCG CAGGACGCTG ACATCGCCAG TGGGTCTGAT
GAAATGCCTT GAGGCCATCA GGGAGTACGC GTTCGTCGCC TCCCCTTACC CCGTCATCCT CACCCTCGAA GATCACCTCA
CTCCCGACCT CCAATCCAAA GTCGCCAAGG TGAACACGCA TTTGCCATCT CGATCACCTC ACCTTCTTCT TCCTCCATAT
ACTGACAATG GCGGCATCGA TCGATGGATT TTCACTCGCG CAGATGATCA AGGAGACGTT CGGTGACATG CTCTACGTCT
CTGAAACTGA GAACATGGCG GAATTCCCTT CGCCGGACGA GCTCAAGGGG AAGATCATCG TGTCGACGAA GCCGCCCAAG
GAGTACCTCC AGACCAAGAA CGACGCCGAC GCCgacgagg ccggcgtctg gggcgaggag atcaccgacg acaaggtggc
ggcgacggcg atgacgacag aagagaaatg cgcggcggcg gaggaagcag tcgccgccgc cgccgtcgac gaggagatgc
aggaggccga gacggacaag aagacgcagc acgggGTGGA CAACGAGTAC AGGCGCCTCA TCGCCATCCC TCTGACAAGA
AGAAAGCACG ACATGGATCA GGACCTCAAG GTCGATCCCG ACATGGTGAC GCGCCTCAGC CTCGGGGAGA AGGCCTACGA
GAAGGCCATT GTCACCCATG GAGCTCACAT TATCAGGTGA TTTCAGCTTT AGTAACATGA CAGGTTTAGT TTGCATGTAC
AGCTTATTCT GAACTGAACT CTGTGTCTGA CAGGATTAGT GTTCTTGTTC TTGTTCTTGT TCAGGTTTAC GCAGAGGAAA
TTGCTGAGGA TATTCCCTCG GTCGACGCGC ATTACGTCTT CGAATTATAA TCCTTTGATG GGTTGGAGGT ATGGAGTTCA
GATGGTTGCA GCAAACATGC AGGTAACTAG TGCAATTTAT GTTATTTCTG TCACACTATT AATAATGGTC TTATTCTGCA
TGATAAGCAC ATGAGTCATC ATGTTTACTT TTTCAGTTCA GCATTGCAAT TGTGTTACAT ATAGTGGAGT GGTATTCTAT
TTAACAAATC ACAACTTAGT TTGAACTAGT GAACTGGGAT ATCCTCTTGC AGAGTTGCAG TATAAAAGGA TTGTAGCAAG
GAAACATTTT TTGTGTCTTT TTCTAAAATC AGGTCTAGCA CAAGGAAAGT ACTGAATAGT TTTTAAAAAA AAGGCTTTGT
GAAGATACAT AATAGTTCAC CCACTTTGAT CTGAGCTATC TGCTACCATT CATGTTCAGG GCCATGGAAG AAAGCTGTGG
CTGACTCAGG GGATGTTCCG AGCAAACGGC GGTTGCGGTT ACGTCAAAAA GCCTGATATT CTGATGAACA ACGATCCAGA
TAAACTGTTT GATCCTACAT CCAAACTACC AGTAAAGACA AGACTAAAGG TAAACTGGAC AAAAGCTAAA TTTCCTTTTA
TTACCGGAAG ATCCCAAATG TGCTACTACT ATTTTTCATA TCTGCTACAG TAACTGAAAG TCTGTAACCA TTGTGTCAAT
GCTACAAAAT CTGAAGGTGA CGGTGTACAT GGGAGACGGA TGGCGATTCG ACTTCCGCAA GACACATTTC GACAAATGCT
CACCCCCAGA CTTCTATGCA AGGGTTAGCA TTCTGATCAA TCTCATGtac tacttccgtt ttttaataga tgatgtcatt
aacttttaga cacatgctta accattcatc ttattcaaaa agtttcgtaa ttatagttta ttttgttgtg agttgttttt
atcactagaa ctactttaaa gcatgattta tatcttatgt atttgcaaaa aaaattaaat aagacgaaga tcaaacgtga
gcccagaagt taacgacgtc tcatctttta aaaaacaaag agagtaCTAC ATATCTAACA AATTAATCGA TTACCTAAGA
TGTACTGAAA CTCTGAATGA GCTGTACACA GAGAAGCAAA CTCTGAATGT TCAGTTCAGA CTTCAGACAT GGCAAATGGC
TGACAAGAAA AGAAAAACTG AAAACTACTG CAGGTGGGTA TAGCCGGAGT AGAAGCAGAC ACGAGGATGG AGCAGACGAA
GGTGAAGATG GACACGTGGA TTCCGGCATG GGATCACGAG TTCGAGTTCC CGTTGAGCGT GCCGGAGCTG GCGCTGCTCC
GGGTGGAGGT GCACGAGTCC GACAACCACC AGAAGGACGA CTTCGGCGGG CAGACCTGCC TGCCGGTGTG GGAGCTCCGG
CGAGGCATCC GCTCCGTCAG GCTCTGCGAC CACCGCGGCG AGCCCCTCCG CTCCGTCAAG CTCCTCATGC GCTTCGACTT
CACCTGACTA CTCCATCTTC TTCTTCATCA TCGTCATCGT CTTAGTAGTA GTAGTTCCAT GTATGATATC ATGAGGGATG
AAGCATTGAT CGtactttct ccgtcccgaa atatagcaat gtaggattag atggaaacat cttaatacta cgaatctgga
tatgtccTAT CTGGTTCTGG TTTGCTATGT TTTAGGACGA ATATAGTACA TAAAATTTTA GAAGTTTTGT TTTAAAAAAG
AATAAATTTT GTGCGAAACG GAAGGTGTGA TTGTACATTT TGTACGTACA TTGTTTGTTG TTGATTAATA AACGTGTTAA
TAAAAGAGGG AAGGATTCTT TT

Locus: Os05g0127200

Loading...

Locus: Os05g0127200

Loading...